Promotions

We provide cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.

Please search for your products from here!

Featured Proteins of Coronavirus Disease 2019 (COVID-19): SARS-CoV-2 Spike RBD Protein, Nucleocapsid Protein, ACE2 Protein

Recombinant SARS-CoV-2 Spike S Protein
Recombinant SARS-CoV-2 Furin TMPRSS2 COVID19

Schematic of the SARS-CoV-2 structure; the illustration of the virus is available at doi: https://doi.org/10.1371/journal.ppat.1008762.g003.

Peptides for COVID-19 Research

                                                                                                                                                                                                                                                                                 
LT55782019 Coronavirus SARS-CoV-2 Receptor Binding Motif  $990     $499,  In Stock
LT5587Coronavirus SARS-CoV-2 Surface Glycoprotein, 74 amino acids  $1000     $100,  In Stock
LT5588South Africa Mutant B.1.1.529: Coronavirus SARS-CoV-2 Surface Glycoprotein, 74 amino acids  $1000  
LT-V007SBP1: Peptide binder to the SARS-CoV-2 spike protein$450, In Stock
LT-V008Biotin-SBP1: Biotin-Peptide binder to the SARS-CoV-2 spike protein$450, In Stock
LT-V012SARS-CoV-2 Receptor Binding Domain Overlapping Peptide Library, 22 Peptides, 15mer, 5 amino acid overlapping  $1980     $1386,  In Stock
LT-V013SARS-CoV-2 Receptor Binding Domain Peptide Library, 4 Peptides, 20mer without overlapping$499,  In Stock
LT-V014Angiotensin-converting enzyme 2 (ACE2) substrates and peptidesCall for Quote,  2-3 weeks
LT-V015Aviptadil (Senatek), Vasoactive intestinal polypeptideCall for Quote,  2-3 weeks
LT-V016CTDpS7 pS7-CTD RNA polymerase II carboxy-terminal domainCall for Quote,  2-3 weeks

Introducing: PepMag Conjugation Magnetic Agarose, 10% bead suspension.    

   
Magnetic bead peptide pulldown

Order PepMag Magnetic Agarose beads for easy peptide conjugation, pull down experiment and binding assays. Simply mix the agarose beads with your peptide through reactions with the amine (NH2-) or thiol (-SH) groups on the peptide. The high surface area of porous magnetic nano-superparamagnetic beads results in high binding capacities. The binding of peptide and magnetic beads is permanent. For binding with your target protein or antibody, simply mix the conjugated beads with your samples, Wash the beads and elute the protein or antibody using 50 mM glycine pH 2.5. Any buffer that breaks the binding between peptide/protein or peptide/antibody can be used for elution.

Multiple tag control protein

Highlights

                                                                                                                                                                                                                                                                                                                         
LT12005Stearyl-R8$260 $150
LTP4418Recombinant Mouse RANKL Protein$1000 $500
download pdf data sheet
LT13501 Macrophage Colony Stimulating Factor (M-CSF)$650 $300
download pdf data sheet
LTCY-0001Mannose-6-phosphate isomerase$1500 $950
LT0425MultiTag Control Protein for Western Blot$250 $149download pdf data sheet
35796Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2$280 $220
LT110006Amylin (1 - 37), human$400 $199
LT2460 Beta-Amyloid (1-42), human$200 $89
L33 Beta-Amyloid (12-28), human$200 $85
L34 Beta-Amyloid (13-28), human$200 $80

Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide or FLAG-Cysteine peptide. Use Code FREEFLAG When Checkout.

Order anti-DYKDDDDK monoclonal antibody from here.


Antibody Products:

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
Cat. No
Product Name
Applications
Price
Download
         Data Sheet
Order
LT0420Anti DYKDDDDK(FLAG)
Monoclonal Antibody

Buy one FLAG antibody,
Get one FLAG peptide for free.
Use Code: FREEFLAG When Checkout.
Dot, ELISA, IS, IP, WB  $190     $150  
download pdf data sheet
add to cart
LT0426Anti His Monoclonal AntibodyDot, ELISA, IP, IS, WB   $190     $80  
download pdf data sheet
add to cart
LT0422Anti HA Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
LT0421Anti cMyc Monoclonal AntibodyDot, ELISA, IP, IS, WB  $210     $150  
download pdf data sheet
add to cart
 LT0423Anti GST Monoclonal AntibodyDot, ELISA, IP, IS, WB  $220     $150  
download pdf data sheet
add to cart
 LT9992Anti V5 Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
 LT9993Anti RFP Monoclonal AntibodyDot, ELISA, IP, IS, WB$200
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $200    
download pdf data sheet
add to cart
LT9999Anti β-Actin Monoclonal AntibodyDot, ELISA, IS, WB$250 
download pdf data sheet
add to cart
 LT9995Anti GAPDH Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
LT9991Anti β Tubulin Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
 LT9998Anti ERK1 (E19) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9997Anti ERK1 (E32) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9996Anti ERK1/2 Monoclonal AntibodyWB$300
download pdf data sheet
add to cart
   
$97.20
... more info

AKRGARSTA

Catalog Number: 5677 Category: Peptide Sequence: AKRGARSTA Modifications: Quantity: 5-9mg Purity: 90.22 % Notes:
$175.20
... more info

ALDFIFPHTPH

Catalog Number: 5543 Category: Peptide Sequence: ALDFIFPHTPH Modifications: Quantity: 1-4mg Purity: 99.17 % Notes:
$271.20
... more info

ALEHLFTLYEKALKALEDLLKKLL

Catalog Number: 6173 Category: Peptide Sequence: ALEHLFTLYEKALKALEDLLKKLL Modifications: Quantity: 1-4mg Purity: 94.57 % Notes:
$324.00
... more info

ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR

Catalog Number: 5755 Category: Peptide Sequence: ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 5-9mg Purity: 84.56 % Notes:
$156.00
... more info

ALHPELR

Catalog Number: 5428 Category: Peptide Sequence: ALHPELR Modifications: Quantity: 10mg Purity: 99.68 % Notes:
$450.00
... more info

ALHRLSPGPRAY-Ahx-Cys

Catalog Number: 5948 Category: Peptide Sequence: ALHRLSPGPRAY-Ahx-Cys Modifications: Quantity: 10mg Purity: 94.15 % Notes:
$757.20
... more info

ALKIDNLD

Catalog Number: 6165 Category: Peptide Sequence: ALKIDNLD Modifications: Quantity: 4mg Purity: 98.07 % Notes:
$192.00
... more info

ALLDPSQGMG PSLIGLAMGD

Catalog Number: 5506 Category: Peptide Sequence: ALLDPSQGMG PSLIGLAMGD Modifications: Quantity: 1-4mg Purity: 95.19 % Notes:
$118.80
... more info

ALLLSAPR

Catalog Number: 5408 Category: Peptide Sequence: ALLLSAPR Modifications: Quantity: 5-9mg Purity: 95.41 % Notes:
$170.40
... more info

ALRLLARSRPLVRAPAAALASAPGL

Catalog Number: 5457 Category: Peptide Sequence: ALRLLARSRPLVRAPAAALASAPGL Modifications: Quantity: 1-4mg Purity: 77.68 % Notes:
Copyright © 2023 LifeTein.com. Powered by LifeTein