Scientific Background | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD is a 42-residue synthetic peptide with the sequence Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp. The sequence contains 2 Lys and 1 Arg residues, contributing cationic character; contains 4 aromatic residues that can contribute to hydrophobic or aromatic interactions; has a relatively high hydrophobic-residue fraction that can influence aqueous solubility and surface adsorption. These sequence-derived properties describe the reagent chemically; no specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |