Promotions

We provide cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.

Please search your products from here!

Promotion: Rabbit Monoclonal Antibodies

Introducing: PepMag Conjugation Magnetic Agarose, 10% bead suspension.

Magnetic bead peptide pulldown

Order PepMag Magnetic Agarose beads for easy peptide conjugation, pull down experiment and binding assays. Simply mix the agarose beads with your peptide through reactions with the amine groups on the peptide. The high surface area of porous magnetic agarose beads results in high binding capacities. The binding of peptide and agarose beads are permanent. For binding with your target protein or antibody, simply mix the conjugated beads with your samples, Wash the beads and elute the protein or antibody using 50 mM glycine pH 2.5. Any buffer that breaks the binding between peptide/protein or peptide/antibody can be used for elution.

Recombinant Protein A Conjugated to Sepharose Resin   Multiple tag control protein

Highlights

LT0425 MultiTag Control Protein for Western Blot $250 $149 download pdf data sheet
35796 Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2 $280 $220
LT110006 Amylin (1 - 37), human $400 $199
LT12005 Stearyl-R8 $260 $150

Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide or FLAG-Cysteine peptide. Use Code FREEFLAG When Checkout.

Order anti-DYKDDDDK monoclonal antibody from here.


Antibody Products:

Cat. No
Product Name
Applications
Price
Download
Data Sheet
Order
LT0420 Anti DYKDDDDK(FLAG)
Monoclonal Antibody

Buy one FLAG antibody,
Get one FLAG peptide for free.
Use Code: FREEFLAG When Checkout.
Dot, ELISA, IS, IP, WB   $190     $150  
download pdf data sheet
add to cart
LT0426 Anti His Monoclonal Antibody Dot, ELISA, IP, IS, WB    $190     $50  
download pdf data sheet
add to cart
LT0422 Anti HA Monoclonal Antibody Dot, ELISA, IP, IS, WB $110
download pdf data sheet
add to cart
LT0421 Anti cMyc Monoclonal Antibody Dot, ELISA, IP, IS, WB   $210     $150  
download pdf data sheet
add to cart
 LT0423 Anti GST Monoclonal Antibody Dot, ELISA, IP, IS, WB   $220     $120  
download pdf data sheet
add to cart
 LT9992 Anti V5 Monoclonal Antibody Dot, ELISA, IP, IS, WB $150
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $100 
download pdf data sheet
add to cart
 LT9993 Anti RFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $110
download pdf data sheet
add to cart
LT9999 Anti β-Actin Monoclonal Antibody Dot, ELISA, IS, WB   $210     $150   
download pdf data sheet
add to cart
 LT9995 Anti GAPDH Monoclonal Antibody Dot, ELISA, IS, WB   $210     $110   
download pdf data sheet
add to cart
LT9991 Anti β Tubulin Monoclonal Antibody Dot, ELISA, IS, WB   $210     $110   
download pdf data sheet
add to cart
 LT9998 Anti ERK1 (E19) Monoclonal Antibody IP, WB $260  
download pdf data sheet
add to cart
 LT9997 Anti ERK1 (E32) Monoclonal Antibody IP, WB $260 
download pdf data sheet
add to cart
 LT9996 Anti ERK1/2 Monoclonal Antibody WB $260
download pdf data sheet
add to cart

$425.00  $290.00
Save: 32% off
... more infoMax: 5

LL-37 (All D amino acid), Antimicrobial Peptide, human

Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, All D amino acids MW: 4493.37 Quantity: 1 mg Purity: >95% by HPLC Appearance: Freeze...
$150.00
... more info

MDFDDDIPF

MDFDDDIPF, 10.2mg, 99.74% purity
$130.00  $89.00
Save: 32% off
... more info

Mechano Growth Factor (MGF), E-domain Native

Product Name Mechano Growth Factor (MGF), E-domain Native Product Description Mechano growth factor (MGF) is a novel splice variant of the...
$250.00  $149.00
Save: 40% off
... more info

MultiTag Protein

The multi-tag positive loading control protein is used to demonstrate that your Western Blot protocol is efficient and correct and that the antibody...
$340.00  $280.00
Save: 18% off
... more info

Myelin Oligodendrocyte Glycoprotein (MOG), Mouse MOG (35-55)

Product Name Myelin Oligodendrocyte Glycoprotein (MOG), Mouse MOG (35-55) Product Description Myelin oligodendrocyte glycoprotein (MOG) 35-55,...
$400.00  $200.00
Save: 50% off
... more info

NDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLE-NH2

Product Name NDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLE-NH2 Size 1 mg Catalog # LT441775 US$ $400 Purity >95% Description...
$100.00
... more info

Ni Sepharose FF Agarose

Catalog Number: LT22871 Data File: Packing Details: 1 mL resin, crosslinked 6% beaded agarose supplied as 50% slurry Binding Capacity: Binding...
$1.00
... more info

Online Credit Card Payment

Service or product online payment by credit card. Please input the total amount (replace $1 to your total amount). Then click Add to Cart. And follow...
$370.00  $270.00
Save: 27% off
... more info

OVA Peptide (323-339)

Product NameOVA 323-339 is an H-2b-restricted OVA MHC class II epitope , it encompasses an allergenic and antigenic epitope of the ovalbumin protein...
$450.00  $125.00
Save: 72% off
... more info

Peptide (TD1-R8), ACSSSPSKHCGGRRRRRRRR, siRNA delivery peptide

Product Name Peptide (TD1-R8), ACSSSPSKHCGGRRRRRRRR, siRNA delivery peptide Product Description The short synthetic peptide ACSSSPSKHCG (TD1) and...

Featured Products - Promotions

Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2
$280.00  $220.00
Save: 21% off
Amylin (1 - 37), human
$400.00  $199.00
Save: 50% off

New Products For December - Promotions

OVA Peptide (323-339)
OVA Peptide (323-339)
$370.00  $270.00
Save: 27% off
Ghrelin (human)
Ghrelin (human)
$864.00  $300.00
Save: 65% off
Ovalbumin(257-264) antigen peptide
Ovalbumin(257-264) antigen peptide
$120.00  $25.00
Save: 79% off
V5 Epitope Tag
V5 Epitope Tag
$153.00  $130.00
Save: 15% off
Beta-Amyloid (1-42), human
$500.00  $200.00
Save: 60% off
Anti His Monoclonal Antibody
$190.00  $50.00
Save: 74% off
DYKDDDDK-Cysteine
DYKDDDDK-Cysteine
$150.00  $50.00
Save: 67% off
MultiTag Protein
$250.00  $149.00
Save: 40% off
Anti GST Monoclonal Antibody
$220.00  $120.00
Save: 45% off

Monthly Specials For December

Peptide Z
$155.00  $80.00
Save: 48% off
[Pyr3]-Amyloid β-Protein (3-42)
$190.00  $149.00
Save: 22% off
FLAG peptide, DYKDDDDK
$125.00  $88.00
Save: 30% off
FITC-Strearyl-R8
$250.00  $150.00
Save: 40% off
6His-Cysteine, HHHHHH-Cysteine
$120.00  $50.00
Save: 58% off
Mechano Growth Factor (MGF), E-domain Native
$130.00  $89.00
Save: 32% off
Copyright © 2018 LifeTein.com. Powered by LifeTein