
We provide cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.

Please search your products from here!

Promotion: Rabbit Monoclonal Antibodies

Introducing: PepMag Conjugation Magnetic Agarose, 10% bead suspension.

Magnetic bead peptide pulldown

Order PepMag Magnetic Agarose beads for easy peptide conjugation, pull down experiment and binding assays. Simply mix the agarose beads with your peptide through reactions with the amine groups on the peptide. The high surface area of porous magnetic agarose beads results in high binding capacities. The binding of peptide and agarose beads are permanent. For binding with your target protein or antibody, simply mix the conjugated beads with your samples, Wash the beads and elute the protein or antibody using 50 mM glycine pH 2.5. Any buffer that breaks the binding between peptide/protein or peptide/antibody can be used for elution.

Recombinant Protein A Conjugated to Sepharose Resin   Multiple tag control protein


LT12005 Stearyl-R8 $260 $150
LT0425 MultiTag Control Protein for Western Blot $250 $149 download pdf data sheet
35796 Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2 $280 $220
LT110006 Amylin (1 - 37), human $400 $199
LT2460 Beta-Amyloid (1-42), human $200 $89
L33 Beta-Amyloid (12-28), human $200 $85
L34 Beta-Amyloid (13-28), human $200 $80

Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide or FLAG-Cysteine peptide. Use Code FREEFLAG When Checkout.

Order anti-DYKDDDDK monoclonal antibody from here.

Antibody Products:

Cat. No
Product Name
Data Sheet
Monoclonal Antibody

Buy one FLAG antibody,
Get one FLAG peptide for free.
Use Code: FREEFLAG When Checkout.
Dot, ELISA, IS, IP, WB   $190     $150  
download pdf data sheet
add to cart
LT0426 Anti His Monoclonal Antibody Dot, ELISA, IP, IS, WB    $190     $50  
download pdf data sheet
add to cart
LT0422 Anti HA Monoclonal Antibody Dot, ELISA, IP, IS, WB $110
download pdf data sheet
add to cart
LT0421 Anti cMyc Monoclonal Antibody Dot, ELISA, IP, IS, WB   $210     $150  
download pdf data sheet
add to cart
 LT0423 Anti GST Monoclonal Antibody Dot, ELISA, IP, IS, WB   $220     $120  
download pdf data sheet
add to cart
 LT9992 Anti V5 Monoclonal Antibody Dot, ELISA, IP, IS, WB $150
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $100 
download pdf data sheet
add to cart
 LT9993 Anti RFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $110
download pdf data sheet
add to cart
LT9999 Anti β-Actin Monoclonal Antibody Dot, ELISA, IS, WB   $210     $150   
download pdf data sheet
add to cart
 LT9995 Anti GAPDH Monoclonal Antibody Dot, ELISA, IS, WB   $210     $110   
download pdf data sheet
add to cart
LT9991 Anti β Tubulin Monoclonal Antibody Dot, ELISA, IS, WB   $210     $110   
download pdf data sheet
add to cart
 LT9998 Anti ERK1 (E19) Monoclonal Antibody IP, WB $260  
download pdf data sheet
add to cart
 LT9997 Anti ERK1 (E32) Monoclonal Antibody IP, WB $260 
download pdf data sheet
add to cart
 LT9996 Anti ERK1/2 Monoclonal Antibody WB $260
download pdf data sheet
add to cart

... more info

Gap 27, Connexin Mimetic SRPTEKTIFII

Product Name Gap 27, Connexin Mimetic SRPTEKTIFII Size 12.3 mg Catalog # LT53529 US$ $180 Purity 96.55% Description This peptide...
... more info


Product Name MMP-insensitive peptide crosslinker GCRDGDQGIAGFDRCG Size 1,000 mg Catalog # LT318475 US$ $900 Purity >85% Description...
$864.00  $300.00
Save: 65% off
... more info

Ghrelin (human)

Product NameGhrelin (human) Product DescriptionHuman ghrelin (GHR), the endogenous ligand of the growth hormone secretagogue receptor (GHS-R),...
$864.00  $350.00
Save: 59% off
... more info

Ghrelin (human)

Product NameGhrelin (human) Product DescriptionHuman ghrelin (GHR), the endogenous ligand of the growth hormone secretagogue receptor (GHS-R),...
$160.00  $89.00
Save: 44% off
... more info

Glucagon Human

Product NameGlucagon, human CAS# 16941-32-5Product Quantity1 mgCatalog Number LT0541Molecular...
... more info

Goserelin (D-Lys6), Glp-His-Trp-Ser-Tyr-Lys-Leu-Arg-Pro-Gly-NH2,

Product Name Goserelin (D-Lys6), Glp-His-Trp-Ser-Tyr-Lys-Leu-Arg-Pro-Gly-NH2, [D-Lys6]-LH-RH Product Description Luteinizing-hormone-releasing...
... more info


Product Name NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration Size 12 mg Catalog # LT441773 US$ $1,200 Purity...
... more info


Product Name H2N-GGYGGGPGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-CO2H, O is hydroxyprolin Size 1,050 mg Catalog # LT441774 US$ $1,200 Purity...
$250.00  $98.00
Save: 61% off
... more info

HHHHHHC, 6His-Cysteine

Product Name HHHHHHC, 6His-Cysteine Product Description The HHHHHH-Cysteine peptide (6His) is used as a fusion tag for immunoaffinity...
... more info

HIV Pol peptide pool

Item # LifeTein Lot# Sequence Molecular Weight Purity Inventory 1 WV-15 WKGPAKLLWKGEGAV 1639.98 96%   2 RP-15 ...

Featured Products - Promotions

Beta-Amyloid (13-28), human
$200.00  $80.00
Save: 60% off
Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2
$280.00  $220.00
Save: 21% off
Beta-Amyloid (12-28), human
$200.00  $85.00
Save: 58% off
Amylin (1 - 37), human
$400.00  $199.00
Save: 50% off
Beta-Amyloid (1-42), human
$1,000.00  $359.00
Save: 64% off
HHHHHHC, 6His-Cysteine
$250.00  $98.00
Save: 61% off

Monthly Specials For April

Control Peptide, CGPGRGIGKRRHP
$277.00  $150.00
Save: 46% off
$500.00  $400.00
Save: 20% off
$125.00  $88.00
Save: 30% off
HHHHHHC, 6His-Cysteine
$250.00  $98.00
Save: 61% off
Peptide Z
$155.00  $80.00
Save: 48% off
Copyright © 2019 Powered by LifeTein