Promotions

LifeTein offers promotional pricing on selected research peptides, cell-permeable peptides (CPPs), recombinant proteins, and monoclonal antibodies. We also provide a broad catalog of cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, natural proteins, monoclonal antibodies, and polyclonal antibodies for life science research.


   Advanced Search

Featured Peptide Promotions

Explore selected peptide products for sortase-mediated ligation, targeting, labeling, cyclic peptide research, and conjugation workflows. These products are useful in protein labeling, site-specific bioconjugation, targeting studies, and assay development.

Featured LPETG and Sortase Motif Peptides

The LPXTG motif is recognized by Staphylococcus aureus Sortase A (SrtA) and is widely used in site-specific ligation and protein conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and custom-modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA); amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA); free acid form $280
add to cart
5716 Biotin-AALPETG*G 2-hydroxyacetic acid modified LPETG-related peptide $320
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif for sortase-mediated ligation research $280
add to cart
5747 Biotin-ALPETGG LPETG motif peptide for SrtA-related applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled LPETG peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Fluorescent and Labeled LPETGS / LPETGG Peptides

These labeled LPETG-related peptides are useful for fluorescence-based tracking, conjugation, imaging, and ligation studies. Additional fluorescent dyes, PEGs, and custom modifications are available upon request.

Product Application
Cys-LPETGSReactive cysteine-containing LPETGS peptide
FITC-Ahx-LPETGSFITC-labeled LPETGS peptide
Rhodamine B-Ahx-LPETGSRhodamine-labeled LPETGS peptide
800CW-Ahx-LPETGGIRDye 800CW-labeled peptide
700DX-Ahx-LPETGGIRDye 700DX-labeled peptide
Alexa 647-C-LPETGAlexa 647 conjugation on cysteine
{Cy3}-CLPETGGCy3-labeled peptide
JF549-LPETGGJF549 NHS ester conjugation
Biotin-K(Cy5.5)-LPETGGBiotin and Cy5.5 dual-labeled peptide
Ac-K(Cy7)-LPETGGCy7 NHS conjugation on lysine side chain
Ac-K(Cy3)-LPETGGCy3 NHS conjugation on lysine side chain
Ac-K(Cy5.5)-LPETGGCy5.5 NHS conjugation on lysine side chain
Cy5-GLPETGGCy5 conjugation on N-terminus
Alexa546-GGLPETGGHHAlexa546-labeled LPETGG peptide

Featured Cell-Permeable Peptides (CPPs)

Cell-permeable peptides (CPPs) are short peptides, typically 10-30 amino acids in length, that can cross cellular membranes independently of a membrane receptor. These peptides are widely used for intracellular delivery of peptides, proteins, fluorescent dyes, nucleic acids, and nanoparticles.

LifeTein offers a variety of in-stock CPPs and CPP variants ready for conjugation or direct use in research applications. View the full category of Cell Permeable Peptides.

Cat. No. Product Price / Availability
LT12005 Stearyl-R8: Stearyl-RRRRRRRR-NH2 $260 $150, In Stock
LT12013 FITC-R8: FITC-Stearyl-RRRRRRRR $250 $150, In Stock
LT35796 C(Npys)-(Arg)9: C(Npys)RRRRRRRRR-NH2 $280 $220, In Stock
LT1615 TAT (47-57): YGRKKRRQRRR $262 $162, In Stock
LT5549 HIV-1 Tat (48-60): GRKKRRQRRRPPQ $280 $219, In Stock

Additional CPPs and Variants

We offer a wide range of CPPs, including penetratin, TAT variants, oligomeric arginine peptides, transdermal peptides, targeting peptides, and fusion peptides. Many are available in stock as crude peptides, with HPLC purification available in approximately 5 business days.

CPP Family Examples Availability
Antennapedia Peptide RQIKIWFQNRRMKWKK
C(Npys)-RQIKIWFQNRRMKWKK
C-RQIKIWFQNRRMKWKK
RQIKIWFQNRRMKWKK-C
In Stock
Penetratin RQIKIWFQNRRMKWKK-GG
C-RQIKIWFQNRRMKWKK-GG
RQIKIWFQNRRMKWKK-GG-C
In Stock
Penetratin and Labeled Antennapedia Peptides RQIRIWFQNRRMRWRR
C-RQIRIWFQNRRMRWRR
{FITC-LC}-RQIKIWFQNRRMKWKK
{5-FAM}-RQIKIWFQNRRMKWKK
{Cy3}-RQIKIWFQNRRMKWKK
{Cy5}-RQIKIWFQNRRMKWKK
{Alexa488}-RQIKIWFQNRRMKWKK
In Stock
(Arg)9 Oligomer Peptides and Labeling Variants Stearyl-R8
FITC-Stearyl-R8
RRRRRRRRRC
C(Npys)RRRRRRRRR
C(Npys)rrrrrrrrr, r = D-amino acid
{FAM}-RRRRRRRRR
{TAMRA}-RRRRRRRRR
{Biotin}-RRRRRRRRR
{Cy Dyes}-RRRRRRRRR
{Alexa Dyes}-RRRRRRRRR
In Stock
TAT (47-57) and Variants YGRKKRRQRRR
C-YGRKKRRQRRR
YGRKKRRQRRR-C
{Biotin}-YGRKKRRQRRR
{FAM}-YGRKKRRQRRR
{TAMRA}-YGRKKRRQRRR
YGRKKRRQRRRGGGC(Npys)
C(Npys)YGRKKRRQRRR-K(FAM)
MDYKDHDGDYKDHDIDYKDDDDK
In Stock
Additional CPPs and Fusion Peptides HIV-1 Tat fusion peptides
TAT GluR23 variants
TAT-NSF222 fusion peptide
TAT-NSF700 fusion peptide
Mastoparan peptide
NGR peptide (CD13 ligand)
Buforin 2
Rabies virus glycoprotein (RVG)
RVG-9R
IKKgamma NEMO binding domain peptide
KALA
SN50 NF-kB inhibitor
pVEC
SV40 NLS peptides
TfR targeting peptide
Transdermal peptide
Transportan
Pep-1
Pep-1-cysteamine
Cardiac targeting peptide (CTP)
Crude peptide in stock; HPLC purification available in 5 business days

Click here for the full list of Cell Permeable Peptides.

Related Featured Peptides

Cat. No. Product Description Price Order
8197 FAM-Cys-iRGD FAM-Cys-Ahx-CRGDKGPDC with disulfide bond $750
add to cart
LT216216 Cyclo RGD peptide CRGDKGPDC-NH2 with disulfide bond $300
add to cart
LT8229 GRGDSC RGD peptide NH2-GRGDSC-COOH $150
add to cart
LT8230 GRGDS RGD peptide NH2-GRGDS-COOH $150
add to cart

Featured Protein Promotions

LifeTein offers selected recombinant proteins and control proteins at promotional pricing for research use. Additional cytokines, growth factors, enzymes, and viral antigens are also available.

Cat. No. Product Price Data Sheet Order
LT13501 Macrophage Colony Stimulating Factor (M-CSF) $650 $300
download pdf data sheet
add to cart
LT0425 MultiTag Control Protein for Western Blot $250 $149 download pdf data sheet

Featured Antibody Promotions

Our featured antibody products include epitope tag antibodies, loading control antibodies, and selected signal transduction antibodies for Western blot, immunoprecipitation, ELISA, and related applications.

Epitope Tag Antibodies

Cat. No. Product Name Applications Price Data Sheet Order
LT0420 Anti DYKDDDDK (FLAG) Monoclonal Antibody
Buy one FLAG antibody and get one FLAG peptide free. Use code: FREEFLAG at checkout.
Dot, ELISA, IS, IP, WB $190 $150
download pdf data sheet
add to cart
LT0426 Anti His Monoclonal Antibody Dot, ELISA, IP, IS, WB $190 $80
download pdf data sheet
add to cart
LT0422 Anti HA Monoclonal Antibody Dot, ELISA, IP, IS, WB $150
download pdf data sheet
add to cart
LT0421 Anti cMyc Monoclonal Antibody Dot, ELISA, IP, IS, WB $210 $150
download pdf data sheet
add to cart
LT0423 Anti GST Monoclonal Antibody Dot, ELISA, IP, IS, WB $220 $150
download pdf data sheet
add to cart
LT9992 Anti V5 Monoclonal Antibody Dot, ELISA, IP, IS, WB $150
download pdf data sheet
add to cart
LT9993 Anti RFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $200
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $200
download pdf data sheet
add to cart

Loading Control Antibodies

Cat. No. Product Applications Price Data Sheet Order
LT9999 Anti β-Actin Monoclonal Antibody Dot, ELISA, IS, WB $250
download pdf data sheet
add to cart
LT9995 Anti GAPDH Monoclonal Antibody Dot, ELISA, IS, WB $250
download pdf data sheet
add to cart
LT9991 Anti β-Tubulin Monoclonal Antibody Dot, ELISA, IS, WB $250
download pdf data sheet
add to cart

Signal Transduction Antibodies

Cat. No. Product Applications Price Data Sheet Order
LT9998 Anti ERK1 (E19) Monoclonal Antibody IP, WB $300
download pdf data sheet
add to cart
LT9997 Anti ERK1 (E32) Monoclonal Antibody IP, WB $300
download pdf data sheet
add to cart
LT9996 Anti ERK1/2 Monoclonal Antibody WB $300
download pdf data sheet
add to cart

Looking for More Promotional Products?

Contact us for special pricing on peptides, recombinant proteins, antibodies, fluorescent conjugates, and custom research reagents.

Request a Quote

Displaying 1071 to 1080 (of 1268 Products)
Price Product Name
$450.00 $350.00Save: 22% off
... more info

SIINFEKL-10mg

Product Name Ovalbumin(257-264) antigen peptide SIINFEKL Product Quantity10mg Purity >95% Catalog Number LT1959 Molecular Weight963.2FormulaC45H74N10O13SequenceSer-Ile-Ile-Asn-Phe-Glu-Lys-Leu, SIINFEKL, CAS No.: 138831-86-4 Product Description OVA...
$350.00 $250.00Save: 29% off
... more info

SIINFEKL-5mg

Product Name Ovalbumin(257-264) antigen peptide SIINFEKL Product Quantity5mg Purity >95% Catalog Number LT1959 Molecular Weight963.2FormulaC45H74N10O13SequenceSer-Ile-Ile-Asn-Phe-Glu-Lys-Leu, SIINFEKL, CAS No.: 138831-86-4 Product Description OVA...
$280.00
... more info

SIINFEKL-Cys

Catalog Number: 5718 Category: Peptide Sequence: SIINFEKL-Cys, SIINFEKL is a well-known epitope derived from the ovalbumin protein (OVA), a major component of egg whites. It represents an 8-amino acid sequence...
$450.00
... more info

SIINFEKLGGSGGGGSGGISQAVHAAHAEINEAGR

Catalog Number: 6061 Category: Peptide Sequence: SIINFEKLGGSGGGGSGGISQAVHAAHAEINEAGR Modifications: Quantity: 4mg Purity: >95% Notes:
$350.00
... more info

SIINTEKL

Catalog Number: 5792 Category: Peptide Sequence: SIINTEKL Modifications: Quantity: 4mg Purity: >95% Notes:
$681.60
... more info

SIRT2 peptide, Ac-Gln-Pro-Lys-Lys(AC)-AMC

Product Name SIRT2 peptide, Ac-Gln-Pro-Lys-Lys(AC)-AMC Product Description The fluorophore can be analyzed with an excitation wavelength of 350-360 nm and an emission wavelength of 450-465 nm. Product Quantity 100.3 mg Purity 99.03% Catalog...
$280.00
... more info

SKITDILAKLGKVLAHV

Catalog Number: 5704 Category: Peptide Sequence: SKITDILAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes:
$250.00
... more info

SKLNHHHHTVHRGHSPG

Catalog Number: 5320 Category: Peptide Sequence: SKLNHHHHTVHRGHSPG Modifications: Quantity: 4 mg Purity: >95% Formula: C82H124N34O22 Molecular Weight: 1938.11 For research purposes only! Not for human or animal therapeutic or...
$350.00
... more info

SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD

Catalog Number: 6154 Category: Peptide Sequence: SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

SLLFLLFSL

Catalog Number: 6203 Category: Peptide Sequence: SLLFLLFSL Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 1071 to 1080 (of 1268 Products)