Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1091 to 1100 (of 2644 Products)
Price Product Name
$1,004.40
... more info

Corticotropin Releasing Factor, human, rat

Product Name Corticotropin Releasing Factor, human, rat Product Quantity 5mg Catalog Number LT1277 Molecular Weight 4575.5 Formula C208H344N60O63S2 Sequence Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-A...
$1,004.40
... more info

Corticotropin Releasing Factor,bovine

Product Name Corticotropin Releasing Factor, bovine Product Quantity 5mg Catalog Number LT1276 Molecular Weight 4697.44 Formula C206H340N60O63S Sequence Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-A...
$1,004.40
... more info

Corticotropin Releasing Factor,ovine

Product Name Corticotropin Releasing Factor, ovine Product Quantity 5mg Catalog Number LT1278 Molecular Weight 4370.41 Formula C205H339N59O63S Sequence Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-As...
$330.48
... more info

Cortistatin 14 (mouse, rat)

Product Name Cortistatin 14 (mouse, rat) Product Quantity 5mg Catalog Number LT1279 Molecular Weight 1721.05 Formula C81H113N19O19S2 Sequence Pro-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys(Disulfide bridge Cys2-Cys13) Product Description ...
$395.28
... more info

Cortistatin 17, human

Product Name Cortistatin 17, human Product Quantity 5mg Catalog Number LT1280 Molecular Weight 2151.54 Formula C96H139N27O24S3 Sequence Asp-Arg-Met-Pro-Cys-Arg-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys (Disulfide bridge Cys5-Cys16) Scientific...
$230.00
... more info

Cortistatin-14, Human

Catalog Number LT9268 Product Name Cortistatin-14, Human Product Quantity 1 mg Sequence PCKNFFWKTFSSCK (Disulfide 2-13) Molecular Weight 1721.0 Purity ≥95% Scientific Background Cortistatin-14 is a cyclic neuropeptide structurally related to...
$322.00
... more info

CRAMP, Mouse

Catalog Number LT9431 Product Name CRAMP, Mouse Product Quantity 1 mg Sequence GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ Molecular Weight 3879.7 Purity ≥95% Scientific Background Mouse CRAMP is the murine cathelicidin-related antimicrobial...
$262.00
... more info

CRAMP, Rat

Catalog Number LT9432 Product Name CRAMP, Rat Product Quantity 0.5 mg Sequence GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ Molecular Weight 3946.9 Purity ≥95% Scientific Background Rat CRAMP is the rat homolog of human LL-37 and is expressed in...
$252.72
... more info

CREB327 (113 - 126)

Product Name CREB327 (113 - 126) Product Quantity 5mg Catalog Number LT1288 Molecular Weight 1731.05 Formula C76H131N25O21 Sequence Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-Lys-Ile-Leu-Asn-Asp Scientific Background CREB327 (113 - 126) is a 14-residue...
$596.16
... more info

CREBtide

Product Name CREBtide Product Quantity 5mg Catalog Number LT1289 Molecular Weight 1699.01 Formula C73H127N29O18 Sequence Lys-Arg-Arg-Glu-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg Scientific Background CREBtide is a 13-residue synthetic peptide with the...
Displaying 1091 to 1100 (of 2644 Products)