Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1041 to 1050 (of 2644 Products)
Price Product Name
$84.00
... more info

CEF25, Influenza Virus NP (44-52)

Catalog Number LT9381 Product Name CEF25, Influenza Virus NP (44-52) Product Quantity 1 mg Sequence CTELKLSDY Molecular Weight 1071.3 Purity ≥95% Scientific Background Influenza NP(44-52) is an HLA-A*01-restricted nucleoprotein epitope....
$263.52
... more info

CEF3

Product Name CEF3 Product Quantity 10mg Catalog Number LT1238 Molecular Weight 911.12 Formula C42H74N10O12 Sequence Ser-Ile-Ile-Pro-Ser-Gly-Pro-Leu-Lys Scientific Background CEF3 is a 9-residue synthetic peptide with the sequence Ser-Ile-Ile-Pro-Ser...
$80.00
... more info

CEF30, Epstein-Barr Virus BRLF1 (134-142)

Catalog Number LT9386 Product Name CEF30, Epstein-Barr Virus BRLF1 (134-142) Product Quantity 1 mg Sequence ATIGTAMYK Molecular Weight 955.2 Purity ≥95% Scientific Background EBV BRLF1(134-142) is an HLA-A11-restricted epitope from the...
$263.52
... more info

CEF4

Product Name CEF4 Product Quantity 10mg Catalog Number LT1239 Molecular Weight 1148.42 Formula C53H93N15O13 Sequence Arg-Val-Leu-Ser-Phe-Ile-Lys-Gly-Thr-Lys Scientific Background CEF4 is a 10-residue synthetic peptide with the sequence Arg-Val-Leu-S...
$263.52
... more info

CEF6

Product Name CEF6 Product Quantity 10mg Catalog Number LT1240 Molecular Weight 1051.28 Formula C48H78N10O14S1 Sequence Leu-Pro-Phe-Asp-Lys-Thr-Thr-Val-Met Scientific Background CEF6 is a 9-residue synthetic peptide with the sequence Leu-Pro-Phe-Asp-...
$518.40
... more info

Ceratotoxin A

Product Name Ceratotoxin A Product Quantity 5mg Catalog Number LT1241 Molecular Weight 2868.66 Formula C135H243N35O32 Sequence Ser-Ile-Gly-Ser-Ala-Leu-Lys-Lys-Ala-Leu-Pro-Val-Ala-Lys-Lys-Ile-Gly-Lys-Ile-Ala-Leu-Pro-Ile-Ala-Lys-Ala-Ala-Leu-Pro...
$518.40
... more info

Ceratotoxin B

Product Name Ceratotoxin B Product Quantity 5mg Catalog Number LT1242 Molecular Weight 2860.59 Formula C135H235N35O32 Sequence Ser-Ile-Gly-Ser-Ala-Phe-Lys-Lys-Ala-Leu-Pro-Val-Ala-Lys-Lys-Ile-Gly-Lys-Ala-Ala-Leu-Pro-Ile-Ala-Lys-Ala-Ala-Leu-Pro...
$272.16
... more info

CFP10 (71-85)

Product Name CFP10 (71-85) Product Quantity 5mg Catalog Number LT1243 Molecular Weight 1721.91 Formula C72H120N24O25 Sequence Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg Scientific Background CFP10 (71-85) is a 15-residue synthetic...
$302.40
... more info

CFTR (108-117), Pseudomonas aeruginosa Inhibitor

Product Name CFTR (108-117), Pseudomonas aeruginosa Inhibitor Product Quantity 10mg Catalog Number LT1244 Molecular Weight 1252.27 Formula C51H77N15O22 Sequence Ser-Tyr-Asp-Pro-Asp-Asn-Lys-Glu-Glu-Arg Scientific Background CFTR (108-117),...
$469.00
... more info

CGRP (8-37), Human beta

Catalog Number LT9303 Product Name CGRP (8-37), Human beta Product Quantity 1 mg Sequence VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Human beta-CGRP(8-37) is a C-terminal receptor-binding...
Displaying 1041 to 1050 (of 2644 Products)