Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1051 to 1060 (of 2644 Products)
Price Product Name
$240.00
... more info

CGRP Alpha (8-37), Human

Catalog Number LT9211 Product Name CGRP Alpha (8-37), Human Product Quantity 1 mg Sequence VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 Molecular Weight 3125.8 Purity ≥95% Scientific Background Human α-CGRP(8-37) is a truncated calcitonin...
$606.00
... more info

CGRP beta, Human

Catalog Number LT9302 Product Name CGRP beta, Human Product Quantity 0.1 mg Sequence ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide 2-7) Molecular Weight TBD Purity ≥95% Scientific Background Human beta-CGRP is a 37-residue calcitonin-ge...
$2,805.84
... more info

Charybdotoxin

Product Name Charybdotoxin Product Quantity 5mg Catalog Number LT1245 Molecular Weight 4296 Formula C176H277N57O55S7 Sequence Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-...
$183.60
... more info

Cholecystokinin Octapeptide (1-2) (desulfated)

Product Name Cholecystokinin Octapeptide (1-2) (desulfated) Product Quantity 10mg Catalog Number LT1246 Molecular Weight 296.28 Formula C13H16N2O6 Sequence Asp-Tyr Scientific Background Cholecystokinin Octapeptide (1-2) (desulfated) is a synthetic...
$183.60
... more info

Cholecystokinin Octapeptide (1-3) (desulfated)

Product Name Cholecystokinin Octapeptide (1-3) (desulfated) Product Quantity 10mg Catalog Number LT1247 Molecular Weight 427.48 Formula C18H25N3O7S Sequence Asp-Tyr-Met Scientific Background Cholecystokinin Octapeptide (1-3) (desulfated) is a...
$183.60
... more info

Cholecystokinin Octapeptide (1-4) (desulfated)

Product Name Cholecystokinin Octapeptide (1-4) (desulfated) Product Quantity 10mg Catalog Number LT1248 Molecular Weight 484.53 Formula C20H28N4O8S Sequence Asp-Tyr-Met-Gly Scientific Background Cholecystokinin Octapeptide (1-4) (desulfated) is a...
$183.60
... more info

Cholecystokinin Octapeptide (1-5) (desulfated)

Product Name Cholecystokinin Octapeptide (1-5) (desulfated) Product Quantity 10mg Catalog Number LT1249 Molecular Weight 670.75 Formula C31H38N6O9S Sequence Asp-Tyr-Met-Gly-Trp Scientific Background Cholecystokinin Octapeptide (1-5) (desulfated) is...
$183.60
... more info

Cholecystokinin Octapeptide (1-6) (desulfated)

Product Name Cholecystokinin Octapeptide (1-6) (desulfated) Product Quantity 10mg Catalog Number LT1250 Molecular Weight 801.94 Formula C36H47N7O10S2 Sequence Asp-Tyr-Met-Gly-Trp-Met Scientific Background Cholecystokinin Octapeptide (1-6) (desulfate...
$237.60
... more info

Cholecystokinin Octapeptide (2-8) (desulfated)

Product Name Cholecystokinin Octapeptide (2-8) (desulfated) Product Quantity 10mg Catalog Number LT1251 Molecular Weight 948.14 Formula C45H57N9O10S2 Sequence Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 Scientific Background Cholecystokinin Octapeptide (2-8) (d...
$270.00
... more info

Cholecystokinin Octapeptide (desulfated)

Product Name Cholecystokinin Octapeptide (desulfated) Product Quantity 10mg Catalog Number LT1252 Molecular Weight 1063.23 Formula C49H62N10O13S2 Sequence Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 Scientific Background Cholecystokinin Octapeptide (desulfa...
Displaying 1051 to 1060 (of 2644 Products)