Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1081 to 1090 (of 2644 Products)
Price Product Name
$278.64
... more info

Conantokin G

Product Name Conantokin G Product Quantity 5mg Catalog Number LT1268 Molecular Weight 2264.18 Formula C88H138N26O44 Sequence Gly-Glu-Gla-Gla-Leu-Gln-Gla-Asn-Gln-Gla-Leu-Ile-Arg-Gla-Lys-Ser-Asn-NH2 Scientific Background Conantokin G is a synthetic...
$213.84
... more info

Conantokin G (free acid)

Product Name Conantokin G (free acid) Product Quantity 5mg Catalog Number LT1269 Molecular Weight 2265.16 Formula C88H137N25O45 Sequence Gly-Glu-Gla-Gla-Leu-Gln-Gla-Asn-Gln-Gla-Leu-Ile-Arg-Gla-Lys-Ser-Asn Scientific Background Conantokin G (free...
$324.00
... more info

Conantokin T, Marine snail,Conus tullpa

Product Name Conantokin T, Marine snail, Conus tullpa Product Quantity 5mg Catalog Number LT1270 Molecular Weight 2683.9 Formula C110H175N31O45S Sequence Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Lys-Asn-Ala-NH2...
$259.20
... more info

Conopressin S

Product Name Conopressin S Product Quantity 5mg Catalog Number LT1271 Molecular Weight 1028.27 Formula C41H73N17O10S2 Sequence Cys-Ile-Ile-Arg-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6) Scientific Background Conopressin S is a synthetic...
$183.60
... more info

Contraceptive Tetrapeptide

Product Name Contraceptive Tetrapeptide Product Quantity 10mg Catalog Number LT1272 Molecular Weight 500.6 Formula C21H40N8O6 Sequence Thr-Pro-Arg-Lys Scientific Background Contraceptive Tetrapeptide is a 4-residue synthetic peptide with the...
$226.80
... more info

Corazonin, American Cockroach, Periplaneta americana

Product Name Corazonin, American Cockroach, Periplaneta americana Product Quantity 5mg Catalog Number LT1273 Molecular Weight 1369.49 Formula C62H86N18O19 Sequence Pyr-Thr-Phe-Gln-Tyr-Ser-Arg-Gly-Trp-Thr-Asn-NH2 Product Description Corazonin is a...
$790.56
... more info

Corticostatin, human

Product Name Corticostatin, human Product Quantity 5mg Catalog Number LT1274 Molecular Weight 3715.47 Formula C157H261N49O43S6 Sequence Val-Cys-Ser-Cys-Arg-Leu-Val-Phe-Cys-Arg-Arg-Thr-Glu-Leu-Arg-Val-Gly-Asn-Cys-Leu-Ile-Gly-Gly-Val-Ser-Phe-Thr-Tyr-Cy...
$810.00
... more info

Corticostatin, rabbit

Product Name Corticostatin, rabbit Product Quantity 5mg Catalog Number LT1275 Molecular Weight 4003.66 Formula C163H265N63O44S6 Sequence Gly-Ile-Cys-Ala-Cys-Arg-Arg-Arg-Phe-Cys-Pro-Asn-Ser-Glu-Arg-Phe-Ser-Gly-Tyr-Cys-Arg-Val-Asn-Gly-Ala-Arg-Tyr-Val-A...
$208.00
... more info

Corticotropin Releasing Factor (CRF), Human/Rat

Catalog Number LT9323 Product Name Corticotropin Releasing Factor (CRF), Human/Rat Product Quantity 1 mg Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 Molecular Weight 4757.8 Purity ≥95% Scientific Background CRF is a 41-residue...
$175.00
... more info

Corticotropin Releasing Factor (CRF), Ovine

Catalog Number LT9324 Product Name Corticotropin Releasing Factor (CRF), Ovine Product Quantity 0.5 mg Sequence SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 Molecular Weight 4670.7 Purity ≥95% Scientific Background Ovine CRF is a 41-res...
Displaying 1081 to 1090 (of 2644 Products)