Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1031 to 1040 (of 2644 Products)
Price Product Name
$567.00
... more info

Cecropin B, C-Terminal Amide

Catalog Number LT8870 Product Name Cecropin B, C-Terminal Amide Product Quantity 0.5 mg Sequence KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 CAS Number 80451-05-4 Molecular Weight 3834.7 Formula C176H302N52O41S Purity ≥95% Scientific Background ...
$835.92
... more info

Cecropin B, Free Acid

Product Name Cecropin B, Free Acid Product Quantity 5mg Catalog Number LT1235 Molecular Weight 3834.73 Formula C176H302N52O41S Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Le...
$557.28
... more info

Cecropin P1 (porcine)

Product Name Cecropin P1 (porcine) Product Quantity 5mg Catalog Number LT1236 Molecular Weight 3338.93 Formula C147H253N46O43 Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly...
$84.00
... more info

CEF1, Influenza Matrix Protein M1 (58-66)

Catalog Number LT9379 Product Name CEF1, Influenza Matrix Protein M1 (58-66) Product Quantity 1 mg Sequence GILGFVFTL Molecular Weight 966.3 Purity ≥95% Scientific Background Influenza M1(58-66) is an immunodominant HLA-A*02-restricted...
$263.52
... more info

CEF10

Product Name CEF10 Product Quantity 10mg Catalog Number LT1237 Molecular Weight 906.2 Formula C39H71N9O11S1 Sequence Cys-Leu-Gly-Gly-Leu-Leu-Thr-Met-Val Scientific Background CEF10 is a 9-residue synthetic peptide with the sequence Cys-Leu-Gly-Gly-L...
$84.00
... more info

CEF10, Epstein-Barr Virus LMP2 (426-434)

Catalog Number LT9383 Product Name CEF10, Epstein-Barr Virus LMP2 (426-434) Product Quantity 1 mg Sequence CLGGLLTMV Molecular Weight 906.2 Purity ≥95% Scientific Background EBV LMP2(426-434) is an HLA-A2.1-restricted epitope from...
$84.00
... more info

CEF11, Epstein-Barr Virus BMLF1 (280-288)

Catalog Number LT9384 Product Name CEF11, Epstein-Barr Virus BMLF1 (280-288) Product Quantity 1 mg Sequence GLCTLVAML Molecular Weight 920.3 Purity ≥95% Scientific Background EBV BMLF1(280-288) is an HLA-A2.1-restricted epitope from a...
$84.00
... more info

CEF19, Epstein-Barr Virus EBNA3A (458-466)

Catalog Number LT9385 Product Name CEF19, Epstein-Barr Virus EBNA3A (458-466) Product Quantity 1 mg Sequence YPLHEQHGM Molecular Weight 1111.3 Purity ≥95% Scientific Background EBV EBNA3A(458-466) is an HLA-B35-restricted epitope from...
$84.00
... more info

CEF2, Influenza Virus PA (46-54)

Catalog Number LT9380 Product Name CEF2, Influenza Virus PA (46-54) Product Quantity 1 mg Sequence FMYSDFHFI Molecular Weight 1206.4 Purity ≥95% Scientific Background Influenza PA(46-54) is an HLA-A*0201-restricted epitope from the...
$84.00
... more info

CEF20, Cytomegalovirus pp65 (495-503)

Catalog Number LT9382 Product Name CEF20, Cytomegalovirus pp65 (495-503) Product Quantity 1 mg Sequence NLVPMVATV Molecular Weight 943.2 Purity ≥95% Scientific Background CMV pp65(495-503) is a dominant HLA-A*0201-restricted CD8 T-cell...
Displaying 1031 to 1040 (of 2644 Products)