Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1021 to 1030 (of 2644 Products)
Price Product Name
$311.04
... more info

CDR-H3/C2

Product Name CDR-H3/C2 Product Quantity 5mg Catalog Number LT1226 Molecular Weight 2130.26 Formula C98H120N16O34S2 Sequence Cys-Asp-Leu-Ile-Tyr-Tyr-Asp-Tyr-Glu-Glu-Asp-Tyr-Tyr-Phe-Asp-Cys(Disulfide bridge: Cys1-Cys16) Scientific Background CDR-H3/C2...
$263.52
... more info

CEA (605-613)

Product Name CEA (605-613) Product Quantity 10mg Catalog Number LT1227 Molecular Weight 964.09 Formula C43H69N11O14 Sequence Tyr-Leu-Ser-Gly-Ala-Asn-Leu-Asn-Leu Scientific Background CEA (605-613) is a synthetic research peptide in the...
$302.40
... more info

CEA Related, QYSWFVNGTF

Product Name CEA Related, QYSWFVNGTF Product Quantity 10mg Catalog Number LT1228 Molecular Weight 1248.37 Formula C61H77N13O16 Sequence Gln-Tyr-Ser-Trp-Phe-Val-Asn-Gly-Thr-Phe Scientific Background CEA Related, QYSWFVNGTF is a synthetic research...
$270.00
... more info

CEA Related, TYACFVSNL

Product Name CEA Related, TYACFVSNL Product Quantity 10mg Catalog Number LT1229 Molecular Weight 1017.17 Formula C46H68N10O14S Sequence Thr-Tyr-Ala-Cys-Phe-Val-Ser-Asn-Leu Scientific Background CEA Related, TYACFVSNL is a synthetic research peptide...
$270.00
... more info

CEA, CAP-1-6-D, [Asp6] -Carcinoembryonic Antigen

Product Name CEA, CAP-1-6-D, [Asp6] -Carcinoembryonic Antigen Product Quantity 10mg Catalog Number LT1230 Molecular Weight 965.08 Formula C43H68N10O15 Sequence Tyr-Leu-Ser-Gly-Ala-Asp-Leu-Asn-Leu Scientific Background CEA, CAP-1-6-D, [Asp6] -Carcino...
$907.20
... more info

Cecropin A

Product Name Cecropin A Product Quantity 5mg Catalog Number LT1231 Molecular Weight 4003.87 Formula C184H313N53O46 Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Al...
$606.00
... more info

Cecropin A

Catalog Number LT9424 Product Name Cecropin A Product Quantity 0.5 mg Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Molecular Weight 4004.8 Purity ≥95% Scientific Background Cecropin A is a linear cationic antimicrobial peptide...
$285.12
... more info

Cecropin A (1-7)-Melittin A (2-9) amide

Product Name Cecropin A (1-7)-Melittin A (2-9) amide Product Quantity 5mg Catalog Number LT1232 Molecular Weight 1770.34 Formula C89H152N22O15 Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-NH2 Scientific Background Cecropin A...
$486.00
... more info

Cecropin A (1-8)-Melittin (1-18) amide

Product Name Cecropin A (1-8)-Melittin (1-18) amide Product Quantity 5mg Catalog Number LT1233 Molecular Weight 2794.58 Formula C136H233N33O29 Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Il...
$861.84
... more info

Cecropin B

Product Name Cecropin B Product Quantity 5mg Catalog Number LT1234 Molecular Weight 3834.76 Formula C176H302N52O41S1 Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-...
Displaying 1021 to 1030 (of 2644 Products)