Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2231 to 2240 (of 2644 Products)
Price Product Name
$233.28
... more info

Prepro- Atrial Natriuretic Factor (104-116), human

Product Name Prepro- Atrial Natriuretic Factor (104-116), human Product Quantity 5mg Catalog Number LT2074 Molecular Weight 1460.7 Formula C61H113N21O20 Sequence Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg Scientific Background Prepro-...
$356.40
... more info

Prepro-Atrial Natriuretic Factor (104-123) (human)

Product Name Prepro-Atrial Natriuretic Factor (104-123) (human) Product Quantity 5mg Catalog Number LT2083 Molecular Weight 2183.6 Formula C94H171N31O28 Sequence Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg...
$719.28
... more info

Prepro-Atrial Natriuretic Factor (26-55) (human)

Product Name Prepro-Atrial Natriuretic Factor (26-55) (human) Product Quantity 5mg Catalog Number LT2084 Molecular Weight 3508 Formula C152H236N38O51S3 Sequence Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-G...
$881.28
... more info

Prepro-Atrial Natriuretic Factor (56-92) (human)

Product Name Prepro-Atrial Natriuretic Factor (56-92) (human) Product Quantity 5mg Catalog Number LT2085 Molecular Weight 3878.3 Formula C173H270N44O57 Sequence Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-P...
$304.56
... more info

Prepro-Nerve Growth Factor (99-115) (mouse)

Product Name Prepro-Nerve Growth Factor (99-115) (mouse) Product Quantity 5mg Catalog Number LT2088 Molecular Weight 2003.25 Formula C89H139N27O26 Sequence Pro-Glu-Ala-His-Trp-Thr-Lys-Leu-Gln-His-Ser-Leu-Asp-Thr-Ala-Leu-Arg Scientific Background ...
$609.12
... more info

Prepro-Neuromedin S (70-103) (human)

Product Name Prepro-Neuromedin S (70-103) (human) Product Quantity 5mg Catalog Number LT2089 Molecular Weight 3857.5 Formula C180H271N49O44S Sequence Phe-Leu-Phe-His-Tyr-Ser-Arg-Thr-Gln-Glu-Ala-Thr-His-Pro-Val-Lys-Thr-Gly-Phe-Pro-Pro-Val-His-Pro-Leu-...
$589.68
... more info

Prepro-Neuromedin U (104-136) (human)

Product Name Prepro-Neuromedin U (104-136) (human) Product Quantity 5mg Catalog Number LT2090 Molecular Weight 3783.47 Formula C177H277N47O45 Sequence Phe-Leu-Phe-His-Tyr-Ser-Lys-Thr-Gln-Lys-Leu-Gly-Lys-Ser-Asn-Val-Val-Ser-Ser-Val-Val-His-Pro-Leu-Leu...
$453.60
... more info

Preproenkephalin B (186-204), human

Product Name Preproenkephalin B (186-204), human Product Quantity 5mg Catalog Number LT2086 Molecular Weight 1954.97 Formula C78H115N21O36S Sequence Ser-Ser-Glu-Val-Ala-Gly-Glu-Gly-Asp-Gly-Asp-Ser-Met-Gly-His-Glu-Asp-Leu-Tyr Scientific Background ...
$959.04
... more info

Preprogalanin 28-67, rat

Product Name Preprogalanin 28-67, rat Product Quantity 5mg Catalog Number LT2087 Molecular Weight 4489.08 Formula C198H312N62O58 Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-...
$388.00
... more info

Preptin, Human Pro-IGF-II (69-102)

Catalog Number LT9006 Product Name Preptin, Human Pro-IGF-II (69-102) Product Quantity 1 mg Sequence DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL-OH CAS Number 11097-48-6 Molecular Weight 4029.52 Formula C187H275N47O53 Purity ≥95% Scientific Background...
Displaying 2231 to 2240 (of 2644 Products)