Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2221 to 2230 (of 2644 Products)
Price Product Name
$606.00
... more info

Pramlintide

Catalog Number LT9307 Product Name Pramlintide Product Quantity 0.1 mg Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide 2-7) Molecular Weight 3949.4 Purity ≥95% Scientific Background Pramlintide is a three-proline analog of human...
$375.84
... more info

Pre-S1 (12-32)

Product Name Pre-S1 (12-32) Product Quantity 5mg Catalog Number LT2091 Molecular Weight 2296.61 Formula C104H154N26O31S Sequence Met-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro Scientific Background Pre-S1 (12-32)...
$466.56
... more info

Pre-S2 (1-26)

Product Name Pre-S2 (1-26) Product Quantity 5mg Catalog Number LT2092 Molecular Weight 2944.35 Formula C131H199N39O37S Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly Scientific...
$302.40
... more info

Prepro TRH (160-169)

Product Name Prepro TRH (160-169) Product Quantity 10mg Catalog Number LT2075 Molecular Weight 1198.33 Formula C54H75N11O18S1 Sequence Ser-Phe-Pro-Trp-Met-Glu-Ser-Asp-Val-Thr Scientific Background Prepro TRH (160-169) is a synthetic research...
$395.28
... more info

Prepro TRH (178-199)

Product Name Prepro TRH (178-199) Product Quantity 5mg Catalog Number LT2076 Molecular Weight 2618.92 Formula C116H176N28O39S Sequence Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu-Gly-Val-Leu-Met-Pro-Glu Scientific Background ...
$395.28
... more info

Prepro TRH (53-74)

Product Name Prepro TRH (53-74) Product Quantity 5mg Catalog Number LT2077 Molecular Weight 2560.96 Formula C118H182N32O32 Sequence Phe-Leu-Trp-Lys-Asp-Leu-Gln-Arg-Val-Arg-Gly-Asp-Leu-Gly-Ala-Ala-Leu-Asp-Ser-Trp-Ile-Thr Scientific Background Prepro...
$427.68
... more info

Prepro TRH (83-106)

Product Name Prepro TRH (83-106) Product Quantity 5mg Catalog Number LT2078 Molecular Weight 2754.89 Formula C115H176N34O45 Sequence Glu-Glu-Glu-Glu-Lys-Asp-Ile-Glu-Ala-Glu-Glu-Arg-Gly-Asp-Leu-Gly-Glu-Gly-Gly-Ala-Trp-Arg-Leu-His Scientific...
$213.84
... more info

Prepro VIP (111-122) (human)

Product Name Prepro VIP (111-122) (human) Product Quantity 5mg Catalog Number LT2079 Molecular Weight 1242.36 Formula C53H87N13O21 Sequence Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val Scientific Background Prepro VIP (111-122) (human) is a...
$356.40
... more info

Prepro VIP (156-170) (human)

Product Name Prepro VIP (156-170) (human) Product Quantity 5mg Catalog Number LT2080 Molecular Weight 1679.73 Formula C71H106N16O31 Sequence Ser-Ser-Glu-Gly-Glu-Ser-Pro-Asp-Phe-Pro-Glu-Glu-Leu-Glu-Lys Scientific Background Prepro VIP (156-170) (huma...
$1,004.40
... more info

Prepro VIP (81-122) (human)

Product Name Prepro VIP (81-122) (human) Product Quantity 5mg Catalog Number LT2081 Molecular Weight 4552.22 Formula C202H325N53O64S Sequence His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-...
Displaying 2221 to 2230 (of 2644 Products)