Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2241 to 2250 (of 2644 Products)
Price Product Name
$388.00
... more info

Preptin, Human Pro-IGF-II-Derived Peptide

Catalog Number LT8813 Product Name Preptin, Human Pro-IGF-II-Derived Peptide Product Quantity 1 mg Sequence DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL CAS Number 11097-48-6 Molecular Weight 4029.52 Formula C187H275N47O53 Purity ≥95% Scientific...
$220.32
... more info

Pressinoic Acid

Product Name Pressinoic Acid Product Quantity 10mg Catalog Number LT2093 Molecular Weight 774.08 Formula C33H42N8O10S2 Sequence Cys-Tyr-Phe-Gln-Asn-Cys?Disulfide bridge Cys1-Cys6? Scientific Background Pressinoic Acid is a 8-residue synthetic...
$205.20
... more info

Présure. 10. 145-148

Product Name Présure. 10. 145-148 Product Quantity 10mg Catalog Number LT2094 Molecular Weight 902.02 Formula C46H59N7O12 Sequence Ala-Tyr-Phe-Tyr-Pro-Glu-Leu Scientific Background Présure. 10. 145-148 is a 7-residue synthetic peptide with the...
$375.84
... more info

Prion Peptide (106-126),Human

Product Name Prion Peptide (106-126),Human Product Quantity 5mg Catalog Number LT2095 Molecular Weight 1912.28 Formula C80H138N26O24S2 Sequence Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly Scientific Background...
$213.84
... more info

pro - Epsilon - Tx1X/12

Product Name pro - Epsilon - Tx1X/12 Product Quantity 5mg Catalog Number LT2096 Molecular Weight 1539.9 Formula C66H126N26O16 Sequence Leu-Lys-Arg-Thr-Ile-Arg-Thr-Arg-Leu-Asn-Ile-Arg Scientific Background pro - Epsilon - Tx1X/12 is a 12-residue...
$213.84
... more info

Pro-TGF-a

Product Name Pro-TGF-a Product Quantity 5mg Catalog Number LT2129 Molecular Weight 1194.4 Formula C52H87N15O17 Sequence His-Ala-Asp-Leu-Leu-Ala-Val-Val-Ala-Ala-Ser-Gln Scientific Background Pro-TGF-a is a 12-residue synthetic peptide with the...
$183.60
... more info

Proctolin

Product Name Proctolin Product Quantity 10mg Catalog Number LT2102 Molecular Weight 648.77 Formula C30H48N8O8 Sequence Arg-Tyr-Leu-Pro-Thr, RYLPT Product Description Proctolin is a pentapeptide composed of the amino acid sequence Arg-Tyr-Leu-Pro-Thr...
$233.28
... more info

Prodynorphin (228-240),porcine

Product Name Prodynorphin (228-240), porcine Product Quantity 5mg Catalog Number LT2103 Molecular Weight 1570.87 Formula C74H115N21O17 Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr Scientific Background Prodynorphin (228-240),...
$518.40
... more info

Prodynorphin (228-256),porcine

Product Name Prodynorphin (228-256), porcine Product Quantity 5mg Catalog Number LT2104 Molecular Weight 3527.93 Formula C161H236N42O48 Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-P...
$324.00
... more info

proFIX18

Product Name proFIX18 Product Quantity 5mg Catalog Number LT2105 Molecular Weight 2165.5 Formula C95H157N31O27 Sequence Thr-Val-Phe-Leu-Asp-His-Glu-Asn-Ala-Asn-Lys-Ile-Leu-Asn-Arg-Pro-Lys-Arg Scientific Background proFIX18 is a 18-residue synthetic...
Displaying 2241 to 2250 (of 2644 Products)