
We provide cell penetration peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.

  Advanced Search

Featured Peptide Products:

Other related LPETG products:

Cat. No
Product Name
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif in Sortase A (Srt) from Staphylococcus aureus, amidation $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif in Sortase A (Srt) from Staphylococcus aureus, free acid $280
add to cart
5716 Biotin-AALPETG*G, G* is 2-hydroxyacetic acid 2-hydroxyacetic acid modified $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5 Labeling $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Introducing Cell-Permeable Peptides (CPPs)

CPPs have the ability to enter the plasma membrane of a cell independent of a membrane receptor. They are usually small peptides 10–30 residues in length with positively charged amino acid sequences. We have a list of in-stock CPPs ready to conjugate with your targets. Your target can be a peptide, protein, fluorescent dye, or nanoparticle. Click for a full list of Cell Permeable Peptides.

LT12005 Stearyl-R8: Stearyl-RRRRRRRR-NH2   $260     $150,  In Stock
LT12013 FITC-R8: FITC-Stearyl-RRRRRRRR   $250     $150,  In Stock
LT35796 C(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2   $280     $220,  In Stock
LT1615 TAT (47-57): YGRKKRRQRR   $262     $162,  In Stock
LT5549 HIV-1 Tat (48-60): GRKKRRQRRRPPQ   $280     $219,  In Stock

We have a list of in-stock CPPs ready to conjugate with your targets. Your target can be a peptide, protein, fluorescent dye, or nanoparticle. Click for a full list of Cell Permeable Peptides.

Antennapedia Peptide RQIKIWFQNRRMKWKK;
In Stock
(GG linker)
In Stock
and Labeled Antennapedia peptides
In Stock
(Arg)9 Oligomer peptides
Fluorescent Labeling
C(Npys)rrrrrrrrr, r is D amino acid;
{Alexa Dyes}-RRRRRRRRR;
In Stock
TAT (47-57)
and Variants
In Stock
TAT GluR23 variants
TAT-NSF222 Fusion Peptide
TAT-NSF700 Fusion Peptide
HIV-1 Tat (48-60)
Crude Peptide In Stock,
HPLC Purify in 5 Days
Cell Permeable-Mastoparan Peptide
NGR peptide, Aminopeptidase N Ligand (CD13)
NGR Peptide 1
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Buforin 2
Rabies Virus Glycoprotein (RVG)
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
IKKgamma NEMO Binding Domain (NBD) Inhibitory Peptide
NF-kB Inhibitor, SN50
pVEC (Cadherin-5)
SV40 Large T-antigen Nuclear Localization Signal (NLS)
SV40 Large T-antigen Nuclear Localization Signal (NLS) derived peptide
TfR Targeting Peptide
Transdermal Peptide
cardiac targeting peptide (CTP)
CNGRCG (Disulfide bridge: 1-5);
CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5);
Crude Peptide In Stock,
HPLC Purify in 5 Days

Featured Protein Products

LT12005Stearyl-R8$260 $150
LTP4418Recombinant Mouse RANKL Protein$1000 $500
download pdf data sheet
LT13501 Macrophage Colony Stimulating Factor (M-CSF)$650 $300
download pdf data sheet
LTCY-0001Mannose-6-phosphate isomerase$1500 $950
LT0425MultiTag Control Protein for Western Blot$250 $149download pdf data sheet
35796Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2$280 $220
LT110006Amylin (1 - 37), human$400 $199
LT2460 Beta-Amyloid (1-42), human$200 $89
L33 Beta-Amyloid (12-28), human$200 $85
L34 Beta-Amyloid (13-28), human$200 $80

Featured Antibody Products:

Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide or FLAG-Cysteine peptide. Use Code FREEFLAG When Checkout.

Order anti-DYKDDDDK monoclonal antibody now!

Cat. No
Product Name
         Data Sheet
Monoclonal Antibody

Buy one FLAG antibody,
Get one FLAG peptide for free.
Use Code: FREEFLAG When Checkout.
Dot, ELISA, IS, IP, WB  $190     $150  
download pdf data sheet
add to cart
LT0426Anti His Monoclonal AntibodyDot, ELISA, IP, IS, WB   $190     $80  
download pdf data sheet
add to cart
LT0422Anti HA Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
LT0421Anti cMyc Monoclonal AntibodyDot, ELISA, IP, IS, WB  $210     $150  
download pdf data sheet
add to cart
 LT0423Anti GST Monoclonal AntibodyDot, ELISA, IP, IS, WB  $220     $150  
download pdf data sheet
add to cart
 LT9992Anti V5 Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
 LT9993Anti RFP Monoclonal AntibodyDot, ELISA, IP, IS, WB$200
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $200    
download pdf data sheet
add to cart
LT9999Anti β-Actin Monoclonal AntibodyDot, ELISA, IS, WB$250 
download pdf data sheet
add to cart
 LT9995Anti GAPDH Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
LT9991Anti β Tubulin Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
 LT9998Anti ERK1 (E19) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9997Anti ERK1 (E32) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9996Anti ERK1/2 Monoclonal AntibodyWB$300
download pdf data sheet
add to cart
Displaying 141 to 150 (of 1169 Products)
Price Product Name+
$380.00... more info
Catalog Number: 6235 Category: Peptide Sequence: Biotin-Ahx-NANSAVKNNNNEEPSDKHIKEYLNKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6256 Category: Peptide Sequence: Biotin-Ahx-NENANANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6250 Category: Peptide Sequence: Biotin-Ahx-PGSADKPKDQLDYINDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6253 Category: Peptide Sequence: Biotin-Ahx-PGSADKPKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6252 Category: Peptide Sequence: Biotin-Ahx-PGSAGKPKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6248 Category: Peptide Sequence: Biotin-Ahx-PGSAGKSKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6245 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDELDYANDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6251 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDELNYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6246 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLDYANDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
$390.00... more info
Catalog Number: 6247 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 141 to 150 (of 1169 Products)
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2023 Powered by LifeTein