Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 491 to 500 (of 2644 Products)
Price Product Name
$960.00
... more info

Adrenomedullin (1-52), Human

Catalog Number LT9297 Product Name Adrenomedullin (1-52), Human Product Quantity 0.1 mg Sequence YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide 16-21) Molecular Weight 6028.0 Purity ≥95% Scientific Background Human...
$469.00
... more info

Adrenomedullin (22-52), Human

Catalog Number LT9298 Product Name Adrenomedullin (22-52), Human Product Quantity 1 mg Sequence VQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Adrenomedullin(22-52) is a C-terminal human...
$831.00
... more info

Adrenomedullin-2 / Intermedin (1-47), Human

Catalog Number LT9299 Product Name Adrenomedullin-2 / Intermedin (1-47), Human Product Quantity 0.1 mg Sequence TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Adrenomedullin-2, also...
$270.00
... more info

Adrenorphin

Product Name Adrenorphin Product Quantity 10mg Catalog Number LT0911 Molecular Weight 984.2 Formula C44H69N15O9S1 Sequence Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2 Scientific Background Adrenorphin is a 8-residue synthetic peptide with the sequence Tyr-G...
$205.20
... more info

Adrenorphin, Free Acid

Product Name Adrenorphin, Free Acid Product Quantity 10mg Catalog Number LT0912 Molecular Weight 985.18 Formula C44H68N14O10S Sequence Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val Scientific Background Adrenorphin, Free Acid is a 8-residue synthetic peptide...
$194.00
... more info

Adropin (34-76), Human/Mouse/Rat

Catalog Number LT9005 Product Name Adropin (34-76), Human/Mouse/Rat Product Quantity 0.1 mg Sequence CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP-OH Molecular Weight 4501.88 Formula C190H295N55O68S2 Purity ≥95% Scientific Background Adropin(34-...
$205.20
... more info

AF-1

Product Name AF-1 Product Quantity 10mg Catalog Number LT0913 Molecular Weight 3576.06 Formula C45H69N13O10 Sequence Lys-Asn-Glu-Phe-Ile-Arg-Phe-NH2 Scientific Background AF-1 is a 7-residue synthetic peptide with the sequence Lys-Asn-Glu-Phe-Ile-Ar...
$237.60
... more info

AF-2, nematode

Product Name AF-2, nematode Product Quantity 10mg Catalog Number LT0914 Molecular Weight 991.17 Formula C47H70N14O10 Sequence Lys-His-Glu-Tyr-Leu-Arg-Phe-NH2 Scientific Background AF-2, nematode is a 7-residue synthetic peptide with the sequence...
$205.20
... more info

Akt Specific Substrate Peptide, Akt/PKB

Product Name Akt Specific Substrate Peptide, Akt/PKB Product Quantity 10mg Catalog Number LT0922 Molecular Weight 817.95 Formula C36H59N13O9 Sequence Arg-Pro-Arg-Ala-Ala-Thr-Phe Scientific Background Akt Specific Substrate Peptide, Akt/PKB is a...
$152.00
... more info

Akt/PKB Substrate Peptide

Catalog Number LT9475 Product Name Akt/PKB Substrate Peptide Product Quantity 1 mg Sequence RPRAATF Purity ≥95% Scientific Background RPRAATF is a compact serine/threonine kinase substrate motif used in Akt/PKB activity assays and kinase...
Displaying 491 to 500 (of 2644 Products)