Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 501 to 510 (of 2644 Products)
Price Product Name
$252.72
... more info

AKT/PKB/Rac - Protein Kinase Substrate

Product Name AKT/PKB/Rac - Protein Kinase Substrate Product Quantity 5mg Catalog Number LT0923 Molecular Weight 1715.91 Formula C74H114N28O20 Sequence Ala-Arg-Lys-Arg-Glu-Arg-Thr-Tyr-Ser-Phe-Gly-His-His-Ala Scientific Background AKT/PKB/Rac -...
$1,367.28
... more info

Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

Product Name Aldosterone Secretion Inhibiting Factor (1-35) (bovine) Product Quantity 5mg Catalog Number LT0926 Molecular Weight 3910.64 Formula C164H278N58O45S4 Sequence Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg...
... more info

Alexa Fluor 488-Labeled GLP-1 (7-36) Peptide

Product Name Alexa Fluor 488-Labeled GLP-1 (7-36) Peptide Product Quantity 4 mg Catalog Number LT8691 Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-GGGSGGG-C(Alexa488) Purity >95% Modifications Alexa488 conjugation on Cys, TFA removal (HCl),...
... more info

Alexa Fluor 647-Cys-LPETG Sortase A Peptide

Product Name Alexa Fluor 647-Cys-LPETG Sortase A Peptide Product Quantity 4 mg Catalog Number LT8685 Sequence Cys-LPETG Cys-Tyr-Ser-Leu-Pro-Glu-Thr-Gly Purity >95% Modifications Alexa 647 conjugation on Cysteine Peptide Type Sortase A LPETG/LPETG...
... more info

Alexa Fluor 647-Cys-LPETG Sortase A Peptide

Product Name Alexa Fluor 647-Cys-LPETG Sortase A Peptide Product Quantity 4 mg Catalog Number LT8727 Sequence Alexa 647-C-LPETG Ala-Leu-Glu-Ala-Cys-Leu-Pro-Glu-Thr-Gly Purity >95% Peptide Type Sortase A LPETG/LPETGG recognition peptide Published...
... more info

Alexa Fluor 647-Labeled GLP-1 (7-36) Peptide

Product Name Alexa Fluor 647-Labeled GLP-1 (7-36) Peptide Product Quantity 4 mg Catalog Number LT8726 Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-GGGSGGG-C(Alexa647) Purity >95% Modifications Alexa647 conjugation on Cys, TFA removal (HCl),...
$330.48
... more info

Allatotropin, Mas – AT

Product Name Allatotropin, Mas – AT Product Quantity 5mg Catalog Number LT0934 Molecular Weight 1486.8 Formula C65H103N19O17S2 Sequence Gly-Phe-Lys-Asn-Val-Glu-Met-Met-Thr-Ala-Arg-Gly-Phe-NH2 (Disulfide bridge:Cys2-Cys7) Scientific Background ...
$233.28
... more info

Alloferon 1

Product Name Alloferon 1 Product Quantity 5mg Catalog Number LT0935 Molecular Weight 1265.3 Formula C52H76N22O16 Sequence His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly Scientific Background Alloferon 1 is a 13-residue synthetic peptide with...
$213.84
... more info

Alloferon 2

Product Name Alloferon 2 Product Quantity 5mg Catalog Number LT0936 Molecular Weight 1128.2 Formula C46H69N19O15 Sequence Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly Scientific Background Alloferon 2 is a 12-residue synthetic peptide with the...
$205.20
... more info

alpha- Bag Cell Peptide (1 - 8)

Product Name alpha- Bag Cell Peptide (1 - 8) Product Quantity 10mg Catalog Number LT2391 Molecular Weight 1009.19 Formula C47H72N14O11 Sequence Ala-Pro-Arg-Leu-Arg-Phe-Tyr-Ser Scientific Background alpha- Bag Cell Peptide (1 - 8) is a 8-residue...
Displaying 501 to 510 (of 2644 Products)