Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 481 to 490 (of 2644 Products)
Price Product Name
$252.72
... more info

Activity-Dependent Neurotrophic Factor-14

Product Name Activity-Dependent Neurotrophic Factor-14 Product Quantity 5mg Catalog Number LT0885 Molecular Weight 1310.57 Formula C58H103N17O17 Sequence Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala Scientific Background Activity-Dependen...
$239.76
... more info

Acyl Carrier Protein (65-74) (acid)

Product Name Acyl Carrier Protein (65-74) (acid) Product Quantity 5mg Catalog Number LT0887 Molecular Weight 1063.18 Formula C47H74N12O16 Sequence Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly Scientific Background Acyl Carrier Protein (65-74) (acid) is...
$265.68
... more info

Acyl Carrier Protein (65-74) (amide)

Product Name Acyl Carrier Protein (65-74) (amide) Product Quantity 5mg Catalog Number LT0888 Molecular Weight 1062.2 Formula C47H75N13O15 Sequence Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-NH2 Scientific Background Acyl Carrier Protein (65-74) (amide)...
$413.00
... more info

ADAMTS-13 FRET Substrate FRETS-VWF73

Catalog Number LT8947 Product Name ADAMTS-13 FRET Substrate FRETS-VWF73 Product Quantity 1 mg Sequence DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR Molecular Weight 8314.9 Purity ≥95% Scientific...
$215.00
... more info

ADAMTS-4 Aggrecanase FRET Substrate WAAG-3R

Catalog Number LT8806 Product Name ADAMTS-4 Aggrecanase FRET Substrate WAAG-3R Product Quantity 1 mg Sequence Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2 Molecular Weight 1644.8 Purity ≥95% Scientific Background Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2, commonly...
$270.00
... more info

Adipophilin

Product Name Adipophilin Product Quantity 10mg Catalog Number LT0898 Molecular Weight 833.94 Formula C35H63N9O14 Sequence Ser-Val-Ala-Ser-Thr-Ile-Thr-Gly-Val Scientific Background Adipophilin is a 9-residue synthetic peptide with the sequence Ser-Va...
$213.84
... more info

ADP - Ribosylation Factor 6,ARF6 (2 - 13)

Product Name ADP - Ribosylation Factor 6,ARF6 (2 - 13) Product Quantity 5mg Catalog Number LT0899 Molecular Weight 1319.58 Formula C60H102N16O17 Sequence Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu Scientific Background ADP - Ribosylation...
$285.12
... more info

ADP-Ribosylation Factor 1,ARF1 (2 - 17)

Product Name ADP-Ribosylation Factor 1,ARF1 (2 - 17) Product Quantity 5mg Catalog Number LT0900 Molecular Weight 1783.12 Formula C85H131N21O21 Sequence Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu Scientific Background ADP-Ribosyl...
... more info

Adpgk R304M Neoepitope ASMTNMELM

Product Name Adpgk R304M Neoepitope ASMTNMELM Product Quantity 4 mg Catalog Number LT8702 Sequence ASMTNMELM Ala-Ser-Met-Thr-Asn-Met-Glu-Leu-Met Purity >95% Peptide Type Murine MC38 tumor neoepitope peptide Published / Parent Sequence ASMTNMELM...
$233.28
... more info

ADR1 - derived peptide

Product Name ADR1 - derived peptide Product Quantity 5mg Catalog Number LT0901 Molecular Weight 1491.77 Formula C65H114N22O18 Sequence Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln Scientific Background ADR1 - derived peptide is a 13-residue...
Displaying 481 to 490 (of 2644 Products)