Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 471 to 480 (of 2644 Products)
Price Product Name
$205.20
... more info

ACTH (4-10), human

Product Name ACTH (4-10), human Product Quantity 10mg Catalog Number LT0875 Molecular Weight 962.1 Formula C44H59N13O10S1 Sequence Met-Glu-His-Phe-Arg-Trp-Gly Scientific Background ACTH (4-10), human is a synthetic research peptide in the...
$237.60
... more info

ACTH (4-11)

Product Name ACTH (4-11) Product Quantity 10mg Catalog Number LT0876 Molecular Weight 1090.28 Formula C50H71N15O11S Sequence Met-Glu-His-Phe-Arg-Trp-Gly-Lys Scientific Background ACTH (4-11) is a synthetic research peptide in the...
$343.44
... more info

ACTH (6-24), human

Product Name ACTH (6-24), human Product Quantity 5mg Catalog Number LT0878 Molecular Weight 2335.9 Formula C111H175N35O21 Sequence His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Scientific Background ACTH (6-24), human...
$576.72
... more info

ACTH (7- 38), human

Product Name ACTH (7- 38), human Product Quantity 5mg Catalog Number LT0879 Molecular Weight 3659.2 Formula C167H257N47O46 Sequence Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pr...
$122.00
... more info

ACTH (7-38), Human

Catalog Number LT9330 Product Name ACTH (7-38), Human Product Quantity 1 mg Sequence FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE Molecular Weight 3659.4 Purity ≥95% Scientific Background ACTH(7-38), also known as corticotropin-inhibiting peptide,...
$933.12
... more info

ACTH(1-39),human

Product Name ACTH(1-39), human Product Quantity 5mg Catalog Number LT0880 Molecular Weight 4541.1 Formula C207H308N56O58S Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu...
$237.60
... more info

ACTH(4-9), Tyr

Product Name ACTH(4-9), Tyr Product Quantity 10mg Catalog Number LT0881 Molecular Weight 1125.28 Formula C53H68N14O12S Sequence Tyr-Met-Glu-His-Phe-Arg-Trp-Gly Scientific Background ACTH(4-9), Tyr is a synthetic research peptide in the...
$183.60
... more info

ACTH5-10

Product Name ACTH5-10 Product Quantity 10mg Catalog Number LT0882 Molecular Weight 830.91 Formula C39H50N12O9 Sequence Glu-His-Phe-Arg-Trp-Gly Scientific Background ACTH5-10 is a 6-residue synthetic peptide with the sequence Glu-His-Phe-Arg-Trp-Gly....
$272.16
... more info

Activated Protein C (390-404) (human)

Product Name Activated Protein C (390-404) (human) Product Quantity 5mg Catalog Number LT0883 Molecular Weight 1900.18 Formula C91H130N22O23 Sequence Tyr-Gly-Val-Tyr-Thr-Lys-Val-Ser-Arg-Tyr-Leu-Asp-Trp-Ile-His Scientific Background Activated...
$270.00
... more info

Activity – Dependent Neurotrophic Factor, ADNF

Product Name Activity – Dependent Neurotrophic Factor, ADNF Product Quantity 10mg Catalog Number LT0884 Molecular Weight 927.12 Formula C41H74N12O12 Sequence Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala Scientific Background Activity – Dependent...
Displaying 471 to 480 (of 2644 Products)