Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2861 to 2870 (of 3012 Products)
Price Product Name
$80.00
... more info

Temporin L Amide Antimicrobial Peptide

Catalog Number LT8793 Product Name Temporin L Amide Antimicrobial Peptide Product Quantity 1 mg Sequence FVQWFSKFLGRIL-NH2 Molecular Weight 1640.1 Formula C83H122N20O15 Purity ≥95% Scientific Background Temporin L is a 13-residue C-terminally...
$285.12
... more info

TET 830 modified/T – helper epitope from tetanus toxoid

Product Name TET 830 modified/T – helper epitope from tetanus toxoid Product Quantity 5mg Catalog Number LT2290 Molecular Weight 1796.11 Formula C83H134N20O24 Sequence Ala-Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Thr-Glu-Leu, AQYIKANSKFIGITEL...
$252.72
... more info

Tetanus toxin (TT) peptide

Product Name Tetanus toxin (TT) peptide Product Quantity 5mg Catalog Number LT2291 Molecular Weight 1657.95 Formula C79H120N18O21 Sequence Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Phe-Glu Scientific Background Tetanus toxin (TT) peptide is a...
$172.00
... more info

Tetraproline

Catalog Number LT9757 Product Name Tetraproline Sequence PPPP Product Quantity 4 mg Purity ≥95% Molecular Weight 406.48 Formula C20H30N4O5 Scientific Overview A linear four-proline peptide used as an analytical reference and as a compact proline-...
$259.20
... more info

TGF a (34-43) (rat)

Product Name TGF a (34-43) (rat) Product Quantity 5mg Catalog Number LT2292 Molecular Weight 1078.25 Formula C44H67N15O13S2 Sequence Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys(Disulfide bridge:Cys1-Cys10) Scientific Background TGF a (34-43) (rat) is a...
$280.00
... more info

TGN46 Residues 252-267 Peptide

Catalog Number LT9691 Product Name TGN46 Residues 252-267 Peptide Sequence VVPEQPSWKDHSKPIS Product Quantity 4 mg Purity ≥95% Molecular Weight 1834.07 Formula C83H128N22O25 Scientific Overview Human trans-Golgi network protein 2 peptide...
$732.00
... more info

Thr2-Amyloid Beta Peptide (1-42)

Catalog Number LT9814 Product Name Thr2-Amyloid Beta Peptide (1-42) Sequence DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Product Quantity 4 mg Purity ≥95% Molecular Weight 4544.13 Formula C204H313N55O61S Scientific Overview The A2T Icelandic...
$168.00
... more info

Thrombin Fluorogenic Substrate, D-Phe-Pro-Arg-AFC

Catalog Number LT8932 Product Name Thrombin Fluorogenic Substrate, D-Phe-Pro-Arg-AFC Product Quantity 10 mg Sequence fPR-AFC Molecular Weight 629.6 Formula C30H34F3N7O5 Purity ≥95% Scientific Background H-D-Phe-Pro-Arg-AFC is a fluorogenic...
$168.00
... more info

Thrombin Fluorogenic Substrate, H-D-Phe-Pro-Arg-AFC

Catalog Number LT8832 Product Name Thrombin Fluorogenic Substrate, H-D-Phe-Pro-Arg-AFC Product Quantity 10 mg Sequence H-D-Phe-Pro-Arg-AFC Molecular Weight 629.6 Formula C30H34F3N7O5 Purity ≥95% Scientific Background H-D-Phe-Pro-Arg-AFC is a...
$152.00
... more info

Thrombin Substrate, Boc-VPR-AMC

Catalog Number LT9363 Product Name Thrombin Substrate, Boc-VPR-AMC Product Quantity 5 mg Sequence Boc-VPR-AMC Molecular Weight TBD Purity ≥95% Scientific Background Boc-VPR-AMC is a fluorogenic substrate containing a thrombin-compatible...
Displaying 2861 to 2870 (of 3012 Products)