Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2681 to 2690 (of 3012 Products)
Price Product Name
$183.60
... more info

Schizophrenia Related Peptide

Product Name Schizophrenia Related Peptide Product Quantity 10mg Catalog Number LT2191 Molecular Weight 331.4 Formula C15H29N3 Sequence Thr-Val-Leu Scientific Background Schizophrenia Related Peptide is a 3-residue synthetic peptide with the...
$213.84
... more info

SCPA

Product Name SCPA Product Quantity 5mg Catalog Number LT2192 Molecular Weight 1277.57 Formula C59H92N18O12S1 Sequence Ala-Arg-Pro-Gly-Tyr-Leu-Ala-Phe-Pro-Arg-Met-NH2 Scientific Background SCPA is a 11-residue synthetic peptide with the sequence Ala-...
$302.40
... more info

SCPB

Product Name SCPB Product Quantity 10mg Catalog Number LT2193 Molecular Weight 1141.43 Formula C52H80N14O11S2 Sequence Met-Asn-Tyr-Leu-Ala-Phe-Pro-Arg-Met-NH2 Scientific Background SCPB is a 9-residue synthetic peptide with the sequence Met-Asn-Tyr-...
$684.00
... more info

Scrambled Amyloid Beta Peptide (1-40), Teplow Control

Catalog Number LT9818 Product Name Scrambled Amyloid Beta Peptide (1-40), Teplow Control Sequence YHAGVDKEVVFDEGGAEHGLAQKIVRGFGVSDVSMIHNLF Product Quantity 4 mg Purity ≥95% Molecular Weight 4329.87 Formula C194H295N53O58S Scientific Overview A...
$664.00
... more info

Scrambled Beta-Amyloid (1-40)

Catalog Number LT9169 Product Name Scrambled Beta-Amyloid (1-40) Product Quantity 0.5 mg Sequence AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA Molecular Weight 4329.9 Purity ≥95% Scientific Background Scrambled Aβ40 preserves the...
$320.00
... more info

Scrambled gp91ds-tat Control Peptide

Catalog Number LT8827 Product Name Scrambled gp91ds-tat Control Peptide Product Quantity 1 mg Sequence YGRKKRRQRRRCLRITRQSR-NH2 Purity ≥95% Scientific Background YGRKKRRQRRRCLRITRQSR-NH2 is the scrambled-sequence control corresponding to the...
$290.00
... more info

Scrambled gp91ds-tat Peptide 2 Control

Catalog Number LT8829 Product Name Scrambled gp91ds-tat Peptide 2 Control Product Quantity 1 mg Sequence RKKRRQRRRCLRITRQSR-NH2 Purity ≥95% Scientific Background RKKRRQRRRCLRITRQSR-NH2 is the scrambled control corresponding to the shortened...
$626.00
... more info

Scrambled LL-37 Control Peptide

Catalog Number LT9806 Product Name Scrambled LL-37 Control Peptide Sequence GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR Product Quantity 4 mg Purity ≥95% Molecular Weight 4493.34 Formula C205H340N60O53 Scientific Overview A composition-matched...
$205.20
... more info

Scrambled TRAP Fragment

Product Name Scrambled TRAP Fragment Product Quantity 10mg Catalog Number LT2194 Molecular Weight 747.9 Formula C34H57N11O8 Sequence Phe-Ser-Leu-Leu-Arg-Asn-NH2 Scientific Background Scrambled TRAP Fragment is a synthetic research peptide in the...
$122.00
... more info

Scrambled ZIP Control Peptide, Myristoylated

Catalog Number LT8787 Product Name Scrambled ZIP Control Peptide, Myristoylated Product Quantity 1 mg Sequence Myr-RLYRKRIWRSAGR Molecular Weight 1928.5 Formula C90H154N30O17 Purity ≥95% Scientific Background Myr-RLYRKRIWRSAGR is the...
Displaying 2681 to 2690 (of 3012 Products)