Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2671 to 2680 (of 3012 Products)
Price Product Name
$483.00
... more info

SARS-CoV-2 Spike RBD (395-430)

Catalog Number LT9408 Product Name SARS-CoV-2 Spike RBD (395-430) Product Quantity 0.5 mg Sequence VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT Molecular Weight 4063.8 Purity ≥95% Scientific Background This 36-residue peptide spans SARS-CoV-2...
$155.00
... more info

SARS-CoV-2 T-cell Antigen I

Catalog Number LT9402 Product Name SARS-CoV-2 T-cell Antigen I Product Quantity 0.25 mg Sequence YLQPRTFLL Molecular Weight TBD Purity ≥95% Scientific Background YLQPRTFLL is a SARS-CoV-2 spike-derived T-cell epitope identified for...
$155.00
... more info

SARS-CoV-2 T-cell Antigen II

Catalog Number LT9403 Product Name SARS-CoV-2 T-cell Antigen II Product Quantity 0.25 mg Sequence GVYFASTEK Molecular Weight TBD Purity ≥95% Scientific Background GVYFASTEK is a SARS-CoV-2 spike-derived peptide included in a defined T-ce...
$170.00
... more info

SARS-CoV-2 T-cell Antigen III

Catalog Number LT9404 Product Name SARS-CoV-2 T-cell Antigen III Product Quantity 0.25 mg Sequence KLPDDFTGCV Molecular Weight TBD Purity ≥95% Scientific Background KLPDDFTGCV is a SARS-CoV-2 spike-derived T-cell antigen closely related...
$155.00
... more info

SARS-CoV-2 T-cell Antigen IV

Catalog Number LT9405 Product Name SARS-CoV-2 T-cell Antigen IV Product Quantity 0.25 mg Sequence SIIAYTMSL Molecular Weight TBD Purity ≥95% Scientific Background SIIAYTMSL is a SARS-CoV-2 spike-derived peptide used as a defined T-cell...
$170.00
... more info

SARS-CoV-2 T-cell Antigen V

Catalog Number LT9406 Product Name SARS-CoV-2 T-cell Antigen V Product Quantity 0.25 mg Sequence NYNYLYRLFR Molecular Weight TBD Purity ≥95% Scientific Background NYNYLYRLFR is a SARS-CoV-2 spike-derived T-cell antigen included in a...
$170.00
... more info

SARS-CoV-2 T-cell Antigen VI

Catalog Number LT9407 Product Name SARS-CoV-2 T-cell Antigen VI Product Quantity 0.25 mg Sequence GYLQPRTFLL Molecular Weight TBD Purity ≥95% Scientific Background GYLQPRTFLL is an N-terminally extended SARS-CoV-2 spike T-cell epitope...
$1,365.12
... more info

Sauvagine, frog

Product Name Sauvagine, frog Product Quantity 5mg Catalog Number LT2190 Molecular Weight 4617.43 Formula C202H348N56O64S Sequence Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-...
$310.00
... more info

SCAMP1 N-Terminal Residues 1-17 Peptide

Catalog Number LT9636 Product Name SCAMP1 N-Terminal Residues 1-17 Peptide Sequence MSDFDSNPFADPDLNNPC Product Quantity 4 mg Purity ≥95% Molecular Weight 1999.11 Formula C84H119N21O32S2 Scientific Overview Secretory carrier-associated membrane...
$310.00
... more info

SCAMP2 N-Terminal Residues 1-17 Peptide

Catalog Number LT9660 Product Name SCAMP2 N-Terminal Residues 1-17 Peptide Sequence MSAFDTNPFADPVDVNPC Product Quantity 4 mg Purity ≥95% Molecular Weight 1940.13 Formula C84H122N20O29S2 Scientific Overview Secretory carrier-associated membrane...
Displaying 2671 to 2680 (of 3012 Products)