Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2701 to 2710 (of 3012 Products)
Price Product Name
$337.00
... more info

Secretoneurin

Catalog Number LT8849 Product Name Secretoneurin Product Quantity 1 mg Sequence TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ CAS Number 149146-12-3 Molecular Weight 3652.2 Formula C159H252N40O58 Purity ≥95% Scientific Background Secretoneurin is a 33-res...
$528.00
... more info

Secretoneurin, Human

Catalog Number LT9230 Product Name Secretoneurin, Human Product Quantity 1 mg Sequence TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ Molecular Weight TBD Purity ≥95% Scientific Background Secretoneurin is a neuropeptide generated from secretogranin II....
$213.84
... more info

Selectin

Product Name Selectin Product Quantity 5mg Catalog Number LT2203 Molecular Weight 1426.75 Formula C62H105N16O18S2 Sequence Cys-Gln-Lys-Leu-Asp-Lys-Ser-Phe-Ser-Met-Ile-Lys Scientific Background Selectin is a 12-residue synthetic peptide with the...
$285.12
... more info

Sendai Virus Nucleoprotein (321-336)

Product Name Sendai Virus Nucleoprotein (321-336) Product Quantity 5mg Catalog Number LT2204 Molecular Weight 1779.93 Formula C85H110N20O23 Sequence His-Gly-Glu-Phe-Ala-Pro-Gly-Asn-Tyr-Pro-Ala-Leu-Trp-Ser-Tyr-Ala Scientific Background Sendai Virus...
$270.00
... more info

Sendai Virus Nucleoprotein (SV9), 324 – 332

Product Name Sendai Virus Nucleoprotein (SV9), 324 – 332 Product Quantity 10mg Catalog Number LT2205 Molecular Weight 949.08 Formula C46H64N10O12 Sequence Phe-Ala-Pro-Gly-Asn-Tyr-Pro-Ala-Leu Scientific Background Sendai Virus Nucleoprotein (SV9),...
$185.00
... more info

Senktide

Catalog Number LT9228 Product Name Senktide Product Quantity 1 mg Sequence succinyl-DFME-NH2 Molecular Weight 620.7 Purity ≥95% Scientific Background Senktide is a synthetic tachykinin analog with high selectivity for the neurokinin-3...
$302.40
... more info

SEQ ID NO:549

Product Name SEQ ID NO:549 Product Quantity 10mg Catalog Number LT2206 Molecular Weight 1238.51 Formula C63H91N13O13 Sequence Phe-Leu-Gly-Lys-Ile-Trp-Pro-Ser-Tyr-Lys Scientific Background SEQ ID NO:549 is a 10-residue synthetic peptide with the...
$272.16
... more info

Ser-Ala-SAP-IIB

Product Name Ser-Ala-SAP-IIB Product Quantity 5mg Catalog Number LT2207 Molecular Weight 1046.24 Formula C42H71N13O14S2 Sequence Ser-Ala-Lys-Leu-Cys-Pro-Gly-Gly-Asn-Cys-Val (Disulfide bond) Scientific Background Ser-Ala-SAP-IIB is a 11-residue...
$205.00
... more info

SERCA3 ATPase Residues 29-39 Peptide

Catalog Number LT9561 Product Name SERCA3 ATPase Residues 29-39 Peptide Sequence VTDARERYGPN Product Quantity 4 mg Purity ≥95% Molecular Weight 1277.36 Formula C53H84N18O19 Scientific Overview SERCA3 ATPase peptide corresponding to residues 29-39...
$220.32
... more info

Serum Thymic Factor

Product Name Serum Thymic Factor Product Quantity 10mg Catalog Number LT2208 Molecular Weight 858.89 Formula C33H54N12O15 Sequence Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn Scientific Background Serum Thymic Factor is a 8-residue synthetic peptide with...
Displaying 2701 to 2710 (of 3012 Products)