Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2711 to 2720 (of 3012 Products)
Price Product Name
$345.60
... more info

SH2 Domain Ligand (1)

Product Name SH2 Domain Ligand (1) Product Quantity 5mg Catalog Number LT2210 Molecular Weight 857.93 Formula C36H56N7O13PS Sequence Ac-Asp-Tyr(PO3H2)-Val-Pro-Met-Leu-NH2 Scientific Background SH2 Domain Ligand (1) is a 6-residue synthetic peptide...
$345.60
... more info

SH2 Domain Ligand (2)

Product Name SH2 Domain Ligand (2) Product Quantity 5mg Catalog Number LT2211 Molecular Weight 1473.57 Formula C66H97N12O24P Sequence Glu-Pro-Gln-pTyr-Glu-Glu-Ile-Pro-Ile-Tyr-Leu Scientific Background SH2 Domain Ligand (2) is a 10-residue synthetic...
$432.00
... more info

SH2 Domain Ligand (3)

Product Name SH2 Domain Ligand (3) Product Quantity 5mg Catalog Number LT2212 Molecular Weight 1813.03 Formula C82H122N15O27PS Sequence Biotin-LC-Glu-Pro-Gln-pTyr-Glu-Glu-Ile-Pro-Ile-Tyr-Leu Scientific Background SH2 Domain Ligand (3) is a 10-residu...
$280.80
... more info

SH2 Domain Ligand (4)

Product Name SH2 Domain Ligand (4) Product Quantity 5mg Catalog Number LT2213 Molecular Weight 951.86 Formula C40H51N5O18P2 Sequence Ac-pTyr-Tyr-pTyr-Ile-Glu Scientific Background SH2 Domain Ligand (4) is a 3-residue synthetic peptide with the...
$388.80
... more info

SH2 Domain Ligand (5)

Product Name SH2 Domain Ligand (5) Product Quantity 5mg Catalog Number LT2214 Molecular Weight 972.05 Formula C41H62N7O16PS Sequence BiotinLC-Tyr(PO3H2)-Glu-Glu-Ile Scientific Background SH2 Domain Ligand (5) is a 4-residue synthetic peptide with...
$265.00
... more info

SH2B2/APS Residues 605-619 Peptide

Catalog Number LT9686 Product Name SH2B2/APS Residues 605-619 Peptide Sequence EATLGRARAVENQYS Product Quantity 4 mg Purity ≥95% Molecular Weight 1664.80 Formula C69H113N23O25 Scientific Overview Mouse SH2B adaptor protein 2 peptide...
$260.00
... more info

Shc pTyr317 Peptide

Catalog Number LT9473 Product Name Shc pTyr317 Peptide Product Quantity 1 mg Sequence LFDDPSpYVNVQNLDK Purity ≥95% Scientific Background Shc pTyr317 creates a Grb2-binding site that links activated receptors to Ras/MAPK signaling. The...
$245.00
... more info

Shc Tyr317 Peptide

Catalog Number LT9472 Product Name Shc Tyr317 Peptide Product Quantity 1 mg Sequence LFDDPSYVNVQNLDK Purity ≥95% Scientific Background Shc Tyr317 is a key adaptor-protein phosphorylation site. The nonphosphorylated sequence serves as a...
$80.00
... more info

Shepherdin (79-87) Peptide

Product Name Shepherdin (79-87) Peptide Product Quantity 1 mg Catalog Number LT9498 Molecular Weight 949.2 Formula C41H64N12O12S Sequence KHSSGCAFL Purity ≥95% Scientific Background Shepherdin(79-87) is a survivin-derived sequence used to...
$625.00
... more info

SHLP3 (Small Humanin-Like Peptide 3)

Catalog Number LT8867 Product Name SHLP3 (Small Humanin-Like Peptide 3) Product Quantity 0.1 mg Sequence MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW Molecular Weight 4380.4 Purity ≥95% Scientific Background SHLP3 is a 38-residue small humanin-like...
Displaying 2711 to 2720 (of 3012 Products)