Catalog Number | LT8867 |
Product Name | SHLP3 (Small Humanin-Like Peptide 3) |
Product Quantity | 0.1 mg |
Sequence | MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW |
Molecular Weight | 4380.4 |
Purity | ≥95% |
Scientific Background | SHLP3 is a 38-residue small humanin-like peptide associated with a short open reading frame in the mitochondrial 16S rRNA region. The exact sequence MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW was reported in the original SHLP family study. Experimental work found that SHLP3 can reduce apoptosis and reactive oxygen species and can increase mitochondrial metabolic activity in selected cell models, supporting its use in mitochondrial-derived peptide, cellular stress and metabolism research. |
Research Applications | - mitochondrial-derived peptide research
- SHLP family structure-function studies
- cellular stress and apoptosis research
- mitochondrial metabolism studies
|
Experimental Notes | SHLP family members have distinct biological profiles. Effects reported for SHLP3 should not be generalized to SHLP1, SHLP2, SHLP4, SHLP5 or SHLP6, and activity remains model- and concentration-dependent. |
Selected References | - Naturally occurring mitochondrial-derived peptides are age-dependent regulators of apoptosis, insulin sensitivity, and inflammatory markers
|
