Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2401 to 2410 (of 2644 Products)
Price Product Name
$80.00
... more info

Shepherdin (79-87) Peptide

Product Name Shepherdin (79-87) Peptide Product Quantity 1 mg Catalog Number LT9498 Molecular Weight 949.2 Formula C41H64N12O12S Sequence KHSSGCAFL Purity ≥95% Scientific Background Shepherdin(79-87) is a survivin-derived sequence used to...
$625.00
... more info

SHLP3 (Small Humanin-Like Peptide 3)

Catalog Number LT8867 Product Name SHLP3 (Small Humanin-Like Peptide 3) Product Quantity 0.1 mg Sequence MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW Molecular Weight 4380.4 Purity ≥95% Scientific Background SHLP3 is a 38-residue small humanin-like...
$427.68
... more info

sHNG, [Gly14] - HN, [Gly14] –Humanin

Product Name sHNG, [Gly14] - HN, [Gly14] –Humanin Product Quantity 5mg Catalog Number LT2215 Molecular Weight 2657.25 Formula C118H202N34O31S2 Sequence Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala...
$194.40
... more info

Sialokinin – 2

Product Name Sialokinin – 2 Product Quantity 5mg Catalog Number LT2216 Molecular Weight 1145.31 Formula C51H76N12O16S Sequence Asp-Thr-Gly-Asp-Lys-Phe-Tyr-Gly-Leu-Met-nh2 Scientific Background Sialokinin – 2 is a 10-residue synthetic peptide with...
$270.00
... more info

Simian Virus 40 Large Tumor Antigen Amino-Terminal Peptide

Product Name Simian Virus 40 Large Tumor Antigen Amino-Terminal Peptide Product Quantity 10mg Catalog Number LT2218 Molecular Weight 1080 Formula C46H76N14O14S Sequence AC-Met-Asp-Arg-Val-Leu-Ser-Arg-Tyr Scientific Background Simian Virus 40 Large...
$207.36
... more info

SIVmac239-1

Product Name SIVmac239-1 Product Quantity 5mg Catalog Number LT2219 Molecular Weight 1590.83 Formula C65H115N21O23S1 Sequence Met-Gly-Val-Arg-Asn-Ser-Val-Leu-Ser-Gly-Lys-Lys-Ala-Asp-Glu Scientific Background SIVmac239-1 is a 15-residue synthetic...
$207.36
... more info

SIVmac239-2

Product Name SIVmac239-2 Product Quantity 5mg Catalog Number LT2220 Molecular Weight 1630.87 Formula C70H123N19O25 Sequence Asn-Ser-Val-Leu-Ser-Gly-Lys-Lys-Ala-Asp-Glu-Leu-Glu-Lys-Ile Scientific Background SIVmac239-2 is a 15-residue synthetic...
$375.84
... more info

SIVmac251 (gp140) Fragment (171-190) [Cys]

Product Name SIVmac251 (gp140) Fragment (171-190) [Cys] Product Quantity 5mg Catalog Number LT2221 Molecular Weight 2643.05 Formula C118H180N30O35S2 Sequence Lys-Phe-Thr-Met-Thr-Gly-Leu-Lys-Arg-Asp-Lys-Thr-Lys-Glu-Tyr-Asn-Glu-Thr-Trp-Tyr-Cys...
$205.20
... more info

SKIGKV - NH2

Product Name SKIGKV - NH2 Product Quantity 10mg Catalog Number LT2222 Molecular Weight 629.81 Formula C28H55N9O7 Sequence Ser-Lys-Ile-Gly-Lys-Val-NH2 Scientific Background SKIGKV - NH2 is a 6-residue synthetic peptide with the sequence Ser-Lys-Ile-G...
$270.00
... more info

SL9, HIV - 1 p17 (77 - 85)

Product Name SL9, HIV - 1 p17 (77 - 85) Product Quantity 10mg Catalog Number LT2223 Molecular Weight 981.1 Formula C44H72N10O15 Sequence Ser-Leu-Tyr-Asn-Thr-Val-Ala-Thr-Leu Product Description HIV-1 gag p17 protein is an attractive target for...
Displaying 2401 to 2410 (of 2644 Products)