PEP1 HCV NS5A Amphipathic Helix Peptide

SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 is a synthetic peptide corresponding to the amphipathic-helix region associated with hepatitis C virus NS5A membrane anchoring. NS5A membrane association depends on an N-terminal amphipathic alpha helix, and perturbation of this membrane-binding element impairs HCV RNA replication. This sequence-defined peptide is useful for studies of NS5A membrane association, amphipathic-helix structure and HCV replication mechanisms.

• HCV NS5A membrane-association studies
• amphipathic-helix structure-function research
• viral replication mechanism studies
• membrane-binding peptide research

This peptide is a research reagent that models an NS5A amphipathic-helix sequence. Statements about inhibition refer to experimental HCV systems and do not imply antiviral clinical efficacy.

1. Amphipathic Helix-Dependent Localization of NS5A Mediates Hepatitis C Virus RNA Replication