Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2281 to 2290 (of 2783 Products)
Price Product Name
$226.80
... more info

Peptide T

Product Name Peptide T Product Quantity 5mg Catalog Number LT2035 Molecular Weight 857.8 Formula C35H55N9O16 Sequence Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr Scientific Background Peptide T is a 8-residue synthetic peptide with the sequence...
$447.12
... more info

Peptide YY (13-36) (canine,mouse, porcine, rat)

Product Name Peptide YY (13-36) (canine, mouse, porcine, rat) Product Quantity 5mg Catalog Number LT2036 Molecular Weight 3014.4 Formula C135H209N41O38 Sequence...
$280.00
... more info

Peptide YY (3-36) human

Product Name Peptide YY (3-36) human Product Quantity 4mg Catalog Number LT2037 Molecular Weight 4049.52 Formula C180H279N53O54 Sequence CAS# 123583-37-9, IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2...
$547.00
... more info

Peptide YY (3-36), Human

Catalog Number LT9346 Product Name Peptide YY (3-36), Human Product Quantity 0.1 mg Sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 Molecular Weight 4049.5 Purity ≥95% Scientific Background PYY(3-36) is generated from PYY by DPP-4 cleavage...
$881.28
... more info

Peptide YY (canine, mouse,porcine, rat)

Product Name Peptide YY (canine, mouse, porcine, rat) Product Quantity 5mg Catalog Number LT2038 Molecular Weight 4240.7 Formula C190H288N54O57 Sequence...
$881.28
... more info

Peptide YY, Human

Product Name Peptide YY, Human Product Quantity 5mg Catalog Number LT2040 Molecular Weight 4309.8 Formula C194H295N55O57 Sequence...
$586.00
... more info

Peptide YY, Human

Catalog Number LT9321 Product Name Peptide YY, Human Product Quantity TBD Sequence YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Peptide YY is a 36-residue amidated gut hormone released...
$835.92
... more info

Peptide YY(3-36), PYY, human

Product Name Peptide YY(3-36), PYY, human Product Quantity 5mg Catalog Number LT2039 Molecular Weight 4049.55 Formula C180H279N53O54 Sequence...
$205.20
... more info

Peptide, C-Terminal Fragment

Product Name Peptide, C-Terminal Fragment Product Quantity 10mg Catalog Number LT1848 Molecular Weight 545.65 Formula C25H39N9O5 Sequence Pro-Gln-Arg-Phe-NH2 Scientific Background Peptide, C-Terminal Fragment is a 4-residue synthetic peptide with...
$320.00
... more info

Peripheral Myelin Protein P0 (180-199), Mouse

Catalog Number LT9197 Product Name Peripheral Myelin Protein P0 (180-199), Mouse Product Quantity 1 mg Sequence SSKRGRQTPVLYAMLDHSRS Molecular Weight 2290.6 Purity ≥95% Scientific Background P0(180-199) is a neuritogenic fragment of...
Displaying 2281 to 2290 (of 2783 Products)