Catalog Number | LT8859 |
Product Name | OVA (241-270) Ovalbumin Peptide |
Product Quantity | 1 mg |
Sequence | SMLVLLPDEVSGLEQLESIINFEKLTEWTS |
Molecular Weight | 3422.1 |
Formula | C154H246N34O51S |
Purity | ≥95% |
Scientific Background | SMLVLLPDEVSGLEQLESIINFEKLTEWTS corresponds to residues 241-270 of chicken ovalbumin. This 30-residue segment contains the well-known OVA257-264 SIINFEKL H-2Kb epitope within a longer native-sequence context and is useful for studies of antigen processing, epitope generation and ovalbumin-specific cellular immunity. |
Research Applications | - antigen-processing studies
- ovalbumin immunology research
- MHC class I epitope-generation studies
- T-cell antigen-presentation research
|
Experimental Notes | The 30-mer should not itself be described as the minimal H-2Kb epitope. SIINFEKL (OVA257-264) is embedded within this longer peptide and may require processing before presentation in assays that depend on the minimal class I ligand. |
Selected References | - Ovalbumin as a model antigen and SIINFEKL presentation
|
