Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1611 to 1620 (of 1968 Products)
Price Product Name
$324.00
... more info

Pep 4AK

Product NamePep 4AKProduct Quantity5mgCatalog Number LT2030Molecular Weight1809.29FormulaC81H153N27O19SequenceLys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2
$375.84
... more info

Pep-1

Product NamePep-1Product DescriptionPEP-1 peptide, which has 21 amino acid residues, is a peptide carrier for the noncovalent delivery of proteins into cells. it consists of three domains: (a) a hydrophobic tryptophan-rich motif containing five...
$557.28
... more info

Peptide B, bovine

Product NamePeptide B, bovineProduct Quantity5mgCatalog Number LT2032Molecular Weight3657.08FormulaC163H239N39O53S2SequencePhe-Ala-Glu-Pro-Leu-Pro-Ser-Glu-Glu-Glu-Gly-Glu-Ser-Tyr-Ser-Lys-Glu-Val-Pro-Glu-Met-Glu-Lys-Arg-Tyr-Gly-Gly-Phe-Met-Arg-Phe
$609.12
... more info

Peptide F, bovine

Product NamePeptide F, bovineProduct Quantity5mgCatalog Number LT2033Molecular...
$324.00
... more info

Peptide Standard 1

Product NamePeptide Standard 1Product Quantity5mgCatalog Number LT2034Molecular Weight2152.52FormulaC98H144N25O26S2SequenceCys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr
$226.80
... more info

Peptide T

Product NamePeptide TProduct Quantity5mgCatalog Number LT2035Molecular Weight857.8FormulaC35H55N9O16SequenceAla-Ser-Thr-Thr-Thr-Asn-Tyr-Thr
$447.12
... more info

Peptide YY (13-36) (canine,mouse, porcine, rat)

Product NamePeptide YY (13-36) (canine,mouse, porcine, rat)Product Quantity5mgCatalog Number LT2036Molecular Weight3014.4FormulaC135H209N41O38SequenceSer-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
$280.00
... more info

Peptide YY (3-36) human

Product Name Peptide YY (3-36) (human) Product Description PYY (3-36) (human), with the sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 and a molecular weight of 4049.52 g/mol, is a biologically active peptide derived from the human...
$881.28
... more info

Peptide YY (canine, mouse,porcine, rat)

Product NamePeptide YY (canine, mouse,porcine, rat)Product Quantity5mgCatalog Number LT2038Molecular...
$881.28
... more info

Peptide YY, Human

Product NamePeptide YY, HumanProduct Quantity5mg Product Description Peptide YY (PYY) is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent. Catalog...
Displaying 1611 to 1620 (of 1968 Products)