Peptides

A generic image

We provide peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.


  Advanced Search
peptide promotion beta amyloid peptide

Order Amylin (1 - 37), human at the discounted price!

Beta-Amyloid (Aβ or Abeta) is a peptide processed from the Amyloid precursor protein. Beta-amyloid protein is a 39-43 amino acid peptide composed of a portion of the transmembrane domain and the extracellular domain of the amyloid precursor protein (APP). APP occurs as several A beta-containing isoforms of 695, 751, and 770 amino acids, with the latter two APP containing a domain that shares structural and functional homologies with Kunitz serine protease inhibitors.

Beta-amyloid plays a central role in information processing in the brain. A certain quantity of protein is necessary for the transmission of information to neurons. A major histopathological hallmark of Alzheimer's disease (AD) is the presence of amyloid deposits in the parenchyma of the amygdala, hippocampus, and neocortex. Aβ40 and Aβ42 are considered neurotoxic, both as deposits in the brain and blood vessels of Alzheimer's disease and Down's syndrome to find patients. It is therefore assumed that the prevention of the senile plaque's known deposits would improve the symptoms of these diseases.


Featured Peptide Products:


Other related LPETG products:

Cat. No
Product Name
Applications
Price
Order
LPETG LPXTG motif
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif in Sortase A (Srt) from Staphylococcus aureus, amidation $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif in Sortase A (Srt) from Staphylococcus aureus, free acid $280
add to cart
5716 Biotin-AALPETG*G, G* is 2-hydroxyacetic acid 2-hydroxyacetic acid modified $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5 Labeling $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Cat. No
Product Name
Applications
Price
Order
 LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
 LT1340 DYKDDDDK-Cysteine peptide (Flag) Control peptide, affinity purification $50
add to cart
 LT12006   HHHHHH-Cysteine Affinity purification   $50  
add to cart
 LT12013 FITC-Stearyl-R8

Cell penetrating peptide,
Stearyl-RRRRRRRRGK(FITC)

$150    $120  
add to cart
 LT12005 Stearyl-R8 Cell penetrating peptide,
Stearyl-RRRRRRRR
$260    $180    
add to cart
 LT12001 PolyLys-Cys-SH KKKKKKC $55    $30  
add to cart
 LT2353 V5 Epitope Tag V5 epitope, affinity purification $153    $130  
add to cart
LT110006 Amylin (1 - 37), human 37 amino acid polypeptide $400  $199  
add to cart
Displaying 1271 to 1280 (of 1968 Products)
Price Product Name
$285.12
... more info

Pentagastrin

Product NamePentagastrinProduct Quantity5mgCatalog Number LT2028Molecular Weight768.79FormulaC37H50N7O9S1SequenceBoc-beta-Ala-Trp-Met-Asp-Phe-NH2
$265.68
... more info

Pep 4A

Product NamePep 4AProduct Quantity5mgCatalog Number LT2029Molecular Weight1424.77FormulaC63H117N21O16SequenceGly-Ser-Val-Val-I le-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2
$324.00
... more info

Pep 4AK

Product NamePep 4AKProduct Quantity5mgCatalog Number LT2030Molecular Weight1809.29FormulaC81H153N27O19SequenceLys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2
$375.84
... more info

Pep-1

Product NamePep-1Product DescriptionPEP-1 peptide, which has 21 amino acid residues, is a peptide carrier for the noncovalent delivery of proteins into cells. it consists of three domains: (a) a hydrophobic tryptophan-rich motif containing five...
$557.28
... more info

Peptide B, bovine

Product NamePeptide B, bovineProduct Quantity5mgCatalog Number LT2032Molecular Weight3657.08FormulaC163H239N39O53S2SequencePhe-Ala-Glu-Pro-Leu-Pro-Ser-Glu-Glu-Glu-Gly-Glu-Ser-Tyr-Ser-Lys-Glu-Val-Pro-Glu-Met-Glu-Lys-Arg-Tyr-Gly-Gly-Phe-Met-Arg-Phe
$609.12
... more info

Peptide F, bovine

Product NamePeptide F, bovineProduct Quantity5mgCatalog Number LT2033Molecular...
$324.00
... more info

Peptide Standard 1

Product NamePeptide Standard 1Product Quantity5mgCatalog Number LT2034Molecular Weight2152.52FormulaC98H144N25O26S2SequenceCys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr
$226.80
... more info

Peptide T

Product NamePeptide TProduct Quantity5mgCatalog Number LT2035Molecular Weight857.8FormulaC35H55N9O16SequenceAla-Ser-Thr-Thr-Thr-Asn-Tyr-Thr
$447.12
... more info

Peptide YY (13-36) (canine,mouse, porcine, rat)

Product NamePeptide YY (13-36) (canine,mouse, porcine, rat)Product Quantity5mgCatalog Number LT2036Molecular Weight3014.4FormulaC135H209N41O38SequenceSer-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
$280.00
... more info

Peptide YY (3-36) human

Product Name Peptide YY (3-36) (human) Product Description PYY (3-36) (human), with the sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 and a molecular weight of 4049.52 g/mol, is a biologically active peptide derived from the human...
Displaying 1271 to 1280 (of 1968 Products)