Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 961 to 970 (of 2644 Products)
Price Product Name
$508.00
... more info

Calcitonin, Salmon

Catalog Number LT9301 Product Name Calcitonin, Salmon Product Quantity 0.1 mg Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide 1-7) Molecular Weight 3432.0 Purity ≥95% Scientific Background Salmon calcitonin is a potent calcitonin-rece...
$237.60
... more info

Calcium-Like Peptide

Product Name Calcium-Like Peptide Product Quantity 10mg Catalog Number LT1194 Molecular Weight 842.1 Formula C40H75N9O10 Sequence Val-Ala-Ile-Thr-Val-Leu-Val-Lys Scientific Background Calcium-Like Peptide is a 8-residue synthetic peptide with the...
$252.72
... more info

Calcium/Calmodulin Dependent Protein Kinase II - g(345 - 358)

Product Name Calcium/Calmodulin Dependent Protein Kinase II - g(345 - 358) Product Quantity 5mg Catalog Number LT1193 Molecular Weight 1450.63 Formula C58H107N21O22 Sequence Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser Scientific...
$270.00
... more info

Calmodulin-Dependent Protein Kinase II (281 - 289)

Product Name Calmodulin-Dependent Protein Kinase II (281 - 289) Product Quantity 10mg Catalog Number LT1195 Molecular Weight 1118.26 Formula C43H71N15O16S2 Sequence Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys Scientific Background Calmodulin-Dependent...
$518.40
... more info

Calmodulin-Dependent Protein Kinase II (281-309)

Product Name Calmodulin-Dependent Protein Kinase II (281-309) Product Quantity 5mg Catalog Number LT1196 Molecular Weight 3374.11 Formula C146H254N46O39S3 Sequence Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Al...
$356.40
... more info

Calmodulin-Dependent Protein Kinase II (290 - 309)

Product Name Calmodulin-Dependent Protein Kinase II (290 - 309) Product Quantity 5mg Catalog Number LT1197 Molecular Weight 2273.88 Formula C103H185N31O24S Sequence Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala...
$285.12
... more info

Caloxin 2A1

Product Name Caloxin 2A1 Product Quantity 5mg Catalog Number LT1198 Molecular Weight 1478.55 Formula C64H91N19O22 Sequence Val-Ser-Asn-Ser-Asn-Trp-Pro-Ser-Phe-Pro-Ser-Ser-Gly-Gly-Gly-NH2 Scientific Background Caloxin 2A1 is a 15-residue synthetic...
$486.00
... more info

Calpain Inhibitor Peptide

Product Name Calpain Inhibitor Peptide Product Quantity 5mg Catalog Number LT1199 Molecular Weight 3136.64 Formula C140H227N35O44S Sequence Asp-Pro-Met-Ser-Ser-Thr-Tyr-Ile-Glu-Glu-Leu-Gly-Lys-Arg-Glu-Val-Thr-Ile-Pro-Pro-Lys-Tyr-Arg-Glu-Leu-Leu-Ala...
$112.00
... more info

Calpain Rhodamine 110 Substrate, (Z-AA)2Rh110

Catalog Number LT8820 Product Name Calpain Rhodamine 110 Substrate, (Z-AA)2Rh110 Product Quantity 5 mg Sequence (Z-AA)2Rh110 Molecular Weight 885.6 Formula C48H47ClN6O11 Purity ≥95% Scientific Background (Z-Ala-Ala)2Rh110 is a rhodamine 110-ba...
$80.00
... more info

Calpain/Proteasome Fluorogenic Substrate, Suc-LLVY-AMC

Catalog Number LT8825 Product Name Calpain/Proteasome Fluorogenic Substrate, Suc-LLVY-AMC Product Quantity 5 mg Sequence Suc-LLVY-AMC CAS Number 94367-21-2 Molecular Weight 763.9 Formula C40H53N5O10 Purity ≥95% Scientific Background Suc-LLVY-A...
Displaying 961 to 970 (of 2644 Products)