Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 971 to 980 (of 2644 Products)
Price Product Name
$343.44
... more info

cAMP Dependent PK Inhibitor (5-22), amide

Product Name cAMP Dependent PK Inhibitor (5-22), amide Product Quantity 5mg Catalog Number LT1200 Molecular Weight 1969.2 Formula C84H137N29O26 Sequence Thr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2 Scientific...
$356.40
... more info

cAMP Dependent PK Inhibitor (5-24)

Product Name cAMP Dependent PK Inhibitor (5-24) Product Quantity 5mg Catalog Number LT1201 Molecular Weight 2222.4 Formula C94H108N32O31 Sequence Thr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-His-Asp Scientific Background ...
$205.20
... more info

cAMP Dependent Protein Kinase Substrate

Product Name cAMP Dependent Protein Kinase Substrate Product Quantity 10mg Catalog Number LT1202 Molecular Weight 770.9 Formula C31H58N14O9 Sequence Arg-Arg-Lys-Ala-Ser-Gly-Pro Scientific Background cAMP Dependent Protein Kinase Substrate is a...
$876.96
... more info

CAP - 18, rabbit

Product Name CAP - 18, rabbit Product Quantity 5mg Catalog Number LT1203 Molecular Weight 4433.49 Formula C202H356N64O47 Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-...
$262.00
... more info

CAP-18, Rabbit

Catalog Number LT9430 Product Name CAP-18, Rabbit Product Quantity 0.5 mg Sequence GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY Molecular Weight 4433.7 Purity ≥95% Scientific Background Rabbit CAP-18 is a cathelicidin-derived antimicrobial...
$395.28
... more info

Carassin (Carrassius Auratus)

Product Name Carassin (Carrassius Auratus) Product Quantity 5mg Catalog Number LT1204 Molecular Weight 2367.83 Formula C103H175N35O27S Sequence Ser-Pro-Ala-Asn-Ala-Gln-Ile-Thr-Arg-Lys-Arg-His-Lys-Ile-Asn-Ser-Phe-Val-Gly-Leu-Met-NH2 Scientific...
$449.28
... more info

Casein Kinase II Assay Kit

Product Name Casein Kinase II Assay Kit Product Quantity 5mg Catalog Number LT1205 Molecular Weight 1264.2 Formula C45H73N19O24 Sequence Arg-Arg-Arg-Asp-Asp-Asp-Ser-Asp-Asp-Asp Scientific Background Casein Kinase II Assay Kit is a 10-residue...
$270.00
... more info

Casein Kinase II Receptor Peptide

Product Name Casein Kinase II Receptor Peptide Product Quantity 10mg Catalog Number LT1206 Molecular Weight 1362.3 Formula C52H87N19O24 Sequence Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu Scientific Background Casein Kinase II Receptor Peptide is a 9-resid...
$302.40
... more info

Casein Kinase II Substrate

Product Name Casein Kinase II Substrate Product Quantity 10mg Catalog Number LT1207 Molecular Weight 1362.3 Formula C52H87N19O24 Sequence Arg-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu Scientific Background Casein Kinase II Substrate is a synthetic...
$170.00
... more info

Casein Kinase II Substrate Peptide

Catalog Number LT9492 Product Name Casein Kinase II Substrate Peptide Product Quantity 1 mg Sequence RRREEETEEE Purity ≥95% Scientific Background This acidic peptide contains the negatively charged sequence context preferred by casein kinase...
Displaying 971 to 980 (of 2644 Products)