Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 231 to 240 (of 2644 Products)
Price Product Name
$712.00
... more info

[Lys22]-Beta-Amyloid (1-42), Italian Mutation

Catalog Number LT9181 Product Name [Lys22]-Beta-Amyloid (1-42), Italian Mutation Product Quantity 0.5 mg Sequence DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA Mutation E22K Molecular Weight TBD Purity ≥95% Scientific Background The E22K...
$233.28
... more info

[Lys3, Phe10, Tyr13] -Autocamtide - 2 - RelatedInhibitory Peptid

Product Name [Lys3, Phe10, Tyr13] -Autocamtide - 2 - RelatedInhibitory Peptid Product Quantity 5mg Catalog Number LT0642 Molecular Weight 1652.93 Formula C74H121N23O20 Sequence Lys-Lys-Lys-Leu-Arg-Arg-Gln-Glu-Ala-Phe-Asp-Ala-Tyr Scientific...
$278.64
... more info

[Lys3] – Bombesin

Product Name [Lys3] – Bombesin Product Quantity 5mg Catalog Number LT0643 Molecular Weight 1591.88 Formula C71H110N22O18S Sequence Pyr -Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Scientific Background [Lys3] – Bombesin is a synthetic...
$1,017.36
... more info

[Lys4] Sarafotoxin S6c

Product Name [Lys4] Sarafotoxin S6c Product Quantity 5mg Catalog Number LT0644 Molecular Weight 2529.87 Formula C105H153N27O36S5 Sequence Cys-Thr-Cys-Lys-Asp-Met-Thr-Asp-Glu-Glu-Cys-Leu-Asn-Phe-Cys-His-Gln-Asp-Val-Ile-Trp [Disulfide bridge Cys1-15,3-...
$183.60
... more info

[Lys6] Leu-Enkephalin

Product Name [Lys6] Leu-Enkephalin Product Quantity 10mg Catalog Number LT0645 Molecular Weight 683.81 Formula C34H49N7O8 Sequence Tyr-Gly-Gly-Phe-Leu-Lys Scientific Background [Lys6] Leu-Enkephalin is a synthetic research peptide in the enkephalin/...
$183.60
... more info

[Lys8,Asn9] Neurotensin LANT-6 (8-13)

Product Name [Lys8, Asn9] Neurotensin LANT-6 (8-13) Product Quantity 10mg Catalog Number LT0646 Molecular Weight 746.91 Formula C36H58N8O9 Sequence Lys-Asn-Pro-Tyr-Ile-Leu Scientific Background [Lys8, Asn9] Neurotensin LANT-6 (8-13) is a synthetic...
$183.60
... more info

[Lys8,Lys9]-Neurotensin (8-13)

Product Name [Lys8, Lys9]-Neurotensin (8-13) Product Quantity 10mg Catalog Number LT0647 Molecular Weight 760.98 Formula C38H64N8O8 Sequence Lys-Lys-Pro-Tyr-Ile-Leu Scientific Background [Lys8, Lys9]-Neurotensin (8-13) is a synthetic research...
$220.32
... more info

[Lys8] Vasopressin

Product Name [Lys8] Vasopressin Product Quantity 1 mg Catalog Number LT0648 Molecular Weight 1056.24 Formula C46H65N13O12S2 Sequence Molecular Details - Sequence: Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2, Disulfide bridge Cys1-Cys6 - Length: 9 amino...
$259.20
... more info

[Lys8]-Conopressin S

Product Name [Lys8]-Conopressin S Product Quantity 5mg Catalog Number LT0649 Molecular Weight 1000.26 Formula C41H73N15O10S2 Sequence Cys-Ile-Ile-Arg-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge Cys1-Cys6) Scientific Background [Lys8]-Conopressin S is...
$239.76
... more info

[Lys8]-Vasotocin (free acid)

Product Name [Lys8]-Vasotocin (free acid) Product Quantity 5mg Catalog Number LT0650 Molecular Weight 1023.21 Formula C43H66N12O13S2 Sequence Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Lys-Gly (Disulfide bridge Cys1-Cys6? Scientific Background [Lys8]-Vasotocin (fr...
Displaying 231 to 240 (of 2644 Products)