| Product Name | [Lys22]-Beta-Amyloid (1-40), E22K Italian Mutation |
| Catalog Number | LT9151 |
| Product Quantity | 0.5 mg |
| Sequence | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV |
| Mutation | E22K (Italian) |
| Molecular Weight | 4328.2 |
| Purity | ≥95% |
| Mechanism & Biological Significance | The Italian E22K substitution reverses the charge at residue 22 of Aβ40 and is associated with hereditary cerebral amyloid angiopathy. Residue 22 is a key determinant of Aβ turn formation, assembly and vascular amyloid behavior. |
| Published Research Context | A peer-reviewed study directly compared synthetic wild-type Aβ40 with the E22K Italian and E22Q Dutch Aβ40 variants. Secondary structure, aggregation, fibrillization and effects on cultured human cerebral endothelial cells were measured, providing direct experimental evidence for the exact E22K Aβ40 construct. |
| Research Applications | - familial cerebral amyloid angiopathy research
- Aβ40 aggregation and fibrillization
- endothelial-cell response studies
- mutation-dependent structure-function comparisons
|
| Experimental Considerations | The mutation and the Aβ40 C-terminal boundary are integral to this construct. Wild-type and mutant peptides should be prepared with matched dissolution, concentration, incubation, buffer and aggregation protocols because Aβ assembly is strongly preparation-dependent. |
| Selected Scientific References | - Substitutions at codon 22 of Alzheimer's Aβ peptide induce diverse conformational changes and apoptotic effects in human cerebral endothelial cells
|
