Catalog Number | LT9151 |
| Product Name | [Lys22]-Beta-Amyloid (1-40), E22K Italian Mutation |
| Product Quantity | 0.5 mg |
| Sequence | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV |
| Molecular Weight | 4329.2 |
| Purity | ≥95% |
| Scientific Background | The E22K Italian mutation replaces Glu22 with Lys in the Aβ40 sequence. This charge-reversing substitution alters local interactions around residues 22–23 and has been investigated for its effects on amyloid assembly, fibril structure and mutation-dependent neurotoxicity. |
| Research Applications | - familial amyloid mutation studies
- Aβ40 aggregation and fibrillization
- cerebral amyloid angiopathy research
- mutant versus wild-type comparisons
|
| Experimental Notes | Mutation identity and the Aβ40 C terminus are integral to this reagent. Compare with wild-type Aβ(1-40) under matched preparation, concentration and incubation conditions because aggregation behavior is strongly protocol-dependent. |
| Selected References | - Selected mutation/amyloid study
|
