Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1981 to 1990 (of 2644 Products)
Price Product Name
$660.96
... more info

Neuropeptide Y (porcine)

Product Name Neuropeptide Y (porcine) Product Quantity 5mg Catalog Number LT1908 Molecular Weight 4253.7 Formula C190H287N55O57 Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-A...
$725.76
... more info

Neuropeptide Y-Lys(Biotin),human, rat; NPY-Lys(Biotin),human, ra

Product Name Neuropeptide Y-Lys(Biotin), human, rat; NPY-Lys(Biotin), human, ra Product Quantity 5mg Catalog Number LT1910 Molecular Weight 4515.1 Formula C199H300N57O60S2 Sequence Biotin-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-As...
$660.96
... more info

Neuropeptide Y, human, rat

Product Name Neuropeptide Y, human, rat Product Quantity 5mg Catalog Number LT1909 Molecular Weight 4271.7 Formula C189H285N55O57S Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Il...
$122.00
... more info

Neuropeptide Y, Human/Rat

Catalog Number LT9236 Product Name Neuropeptide Y, Human/Rat Product Quantity 1 mg Sequence YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Molecular Weight 4272.0 Purity ≥95% Scientific Background Neuropeptide Y is a 36-residue amidated...
$239.76
... more info

Neurotensin

Product Name Neurotensin Product Quantity 5mg Catalog Number LT1911 Molecular Weight 1672.96 Formula C78H121N21O20 Sequence Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu Scientific Background Neurotensin is a synthetic research peptide in the...
$220.32
... more info

Neurotensin (1-11)

Product Name Neurotensin (1-11) Product Quantity 10mg Catalog Number LT1912 Molecular Weight 1446.66 Formula C66H99N19O18 Sequence Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr Scientific Background Neurotensin (1-11) is a synthetic research peptide...
$259.20
... more info

Neurotensin (1-8)

Product Name Neurotensin (1-8) Product Quantity 10mg Catalog Number LT1913 Molecular Weight 1030.15 Formula C46H71N13O14 Sequence Pyr--Leu-Tyr-Glu-Asn-Lys-Pro-Arg Scientific Background Neurotensin (1-8) is a synthetic research peptide in the...
$183.60
... more info

Neurotensin (8-13)

Product Name Neurotensin (8-13) Product Quantity 10mg Catalog Number LT1914 Molecular Weight 817.01 Formula C38H64N12O8 Sequence Arg-Arg-Pro-Tyr-Ile-Leu Scientific Background Neurotensin (8-13) is a synthetic research peptide in the neurotensin...
$205.20
... more info

Neurotensin (8-13), N-Acetyl

Product Name Neurotensin (8-13), N-Acetyl Product Quantity 10mg Catalog Number LT1915 Molecular Weight 859.05 Formula C40H66N12O9 Sequence Ac-Arg-Arg-Pro-Tyr-Ile-Leu Scientific Background Neurotensin (8-13), N-Acetyl is a synthetic research peptide...
$220.32
... more info

Neurotensin (9-13)

Product Name Neurotensin (9-13) Product Quantity 10mg Catalog Number LT1916 Molecular Weight 660.82 Formula C 32H52N8O7 Sequence Arg-Pro-Tyr-Ile-Leu Scientific Background Neurotensin (9-13) is a synthetic research peptide in the neurotensin family....
Displaying 1981 to 1990 (of 2644 Products)