Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 181 to 190 (of 2644 Products)
Price Product Name
$233.28
... more info

[Gln144] - PLP (139 - 151), Q144 - PLP(139 - 151)

Product Name [Gln144] - PLP (139 - 151), Q144 - PLP(139 - 151) Product Quantity 5mg Catalog Number LT0599 Molecular Weight 1463.67 Formula C66H102N20O18 Sequence His-Ser-Leu-Gly-Lys-Gln-Leu-Gly-His-Pro-Asp-Lys-Phe Scientific Background [Gln144] -...
$237.60
... more info

[Gln18]-Platelet Factor 4 (15-22) (human)

Product Name [Gln18]-Platelet Factor 4 (15-22) (human) Product Quantity 10mg Catalog Number LT0600 Molecular Weight 944.06 Formula C38H69N15O13 Sequence Thr-Thr-Ser-Gln-Val-Arg-Pro-Arg Scientific Background [Gln18]-Platelet Factor 4 (15-22) (human)...
$253.00
... more info

[Gln22,Asn23]-Beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa Double Mutation

Product Name [Gln22,Asn23]-Beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa Double Mutation Catalog Number LT9153 Product Quantity 0.5 mg Sequence DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV Mutation E22Q/D23N (Dutch/Iowa double mutation) Molecular...
$650.00
... more info

[Gln22] - 25359 - Amyloid (6 -40)

Product Name [Gln22] - 25359 - Amyloid (6 -40) Product Quantity 5mg Catalog Number LT0601 Molecular Weight 3710.26 Formula C167H258N46O48S Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Il...
$850.00
... more info

[Gln22] -Beta- Amyloid (1 - 40)

Product Name [Gln22] -Beta- Amyloid (1 - 40) Product Quantity 5mg Catalog Number LT0602 Molecular Weight 4328.91 Formula C194H296N54O57S Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-...
$314.00
... more info

[Gln22]-Beta-Amyloid (1-42), E22Q Dutch Mutation

Product Name Beta-Amyloid (1-42), E22Q Dutch Mutation Catalog Number LT9149 Sequence DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA Mutation E22Q Molecular Weight 4513.4 Purity ≥95% Mechanism & Biological Significance The Dutch E22Q mutation...
$226.80
... more info

[Gln4] Neurotensin

Product Name [Gln4] Neurotensin Product Quantity 5mg Catalog Number LT0603 Molecular Weight 1671.9 Formula C78H122N22O19, Sequence Pyr-Leu-Tyr-Gln-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu Scientific Background [Gln4] Neurotensin is a synthetic research...
$220.32
... more info

[Gln8] LH-RH, chicken

Product Name [Gln8] LH-RH, chicken Product Quantity 10mg Catalog Number LT0604 Molecular Weight 1154.28 Formula C54H71N15O14 Sequence Pyr-His-Trp-Ser-Tyr-Gly-Leu-Gln-Pro-Gly-NH2 Scientific Background [Gln8] LH-RH, chicken is a synthetic research...
$850.00
... more info

[Gln9]-Amyloid Beta-Protein (1-40)

Product Name [Gln9]-Amyloid Beta-Protein (1-40) Product Quantity 5mg Catalog Number LT0605 Molecular Weight 4400.98 Formula C197H300N54O59S Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-S...
$252.72
... more info

[Glu1] Fibrinopeptide B, human

Product Name [Glu1] Fibrinopeptide B, human Product Quantity 5mg Catalog Number LT0606 Molecular Weight 1570.6 Formula C66H95N19O26 Sequence Glu-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg Scientific Background [Glu1] Fibrinopeptide B,...
Displaying 181 to 190 (of 2644 Products)