Catalog Number | LT9153 |
| Product Name | [Gln22,Asn23]-Beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa Double Mutation |
| Product Quantity | 0.5 mg |
| Sequence | DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV |
| Molecular Weight | 4328.2 |
| Purity | ≥95% |
| Scientific Background | This Aβ40 construct combines the E22Q Dutch and D23N Iowa substitutions. The double mutation changes two adjacent residues in the central Aβ turn region and has been reported to enhance fibrillogenic and pathogenic behavior relative to wild-type Aβ40, making it useful for comparative cerebral amyloid angiopathy research. |
| Research Applications | - familial amyloid mutation studies
- Aβ40 aggregation and fibrillization
- cerebral amyloid angiopathy research
- mutant versus wild-type comparisons
|
| Experimental Notes | Mutation identity and the Aβ40 C terminus are integral to this reagent. Compare with wild-type Aβ(1-40) under matched preparation, concentration and incubation conditions because aggregation behavior is strongly protocol-dependent. |
| Selected References | - Selected mutation/amyloid study
|
