| Product Name | [Gln22,Asn23]-Beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa Double Mutation |
| Catalog Number | LT9153 |
| Product Quantity | 0.5 mg |
| Sequence | DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV |
| Mutation | E22Q/D23N (Dutch/Iowa double mutation) |
| Molecular Weight | 4328.2 |
| Purity | ≥95% |
| Mechanism & Biological Significance | This Aβ40 construct combines the Dutch E22Q and Iowa D23N cerebral amyloid angiopathy substitutions at adjacent residues 22 and 23. Together they neutralize two acidic side chains in the central turn region and produce a strongly fibrillogenic, vasculotropic experimental Aβ species. |
| Published Research Context | Published experiments directly tested synthetic E22Q/D23N double-mutant Aβ40 together with the corresponding single mutants and wild-type Aβ40. The double mutant rapidly formed fibrils and produced stronger pathological responses in cultured human cerebrovascular smooth-muscle cells than either single-mutant peptide. |
| Research Applications | - double-mutant cerebral amyloid angiopathy models
- Aβ40 fibrillogenesis
- human cerebrovascular smooth-muscle cell studies
- single-versus-double mutation comparisons
|
| Experimental Considerations | The mutation and the Aβ40 C-terminal boundary are integral to this construct. Wild-type and mutant peptides should be prepared with matched dissolution, concentration, incubation, buffer and aggregation protocols because Aβ assembly is strongly preparation-dependent. |
| Selected Scientific References | - Pathogenic effects of D23N Iowa mutant amyloid beta-protein
- Pathogenic effects of cerebral amyloid angiopathy mutations in the amyloid beta-protein precursor
|
