Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1771 to 1780 (of 2644 Products)
Price Product Name
$207.36
... more info

LHRH, salmon

Product Name LHRH, salmon Product Quantity 5mg Catalog Number LT1753 Molecular Weight 1212.36 Formula C60H73N15O13 Sequence Pyr-His-Trp-Ser-Tyr-Gly-Trp-Leu-Pro-Gly-NH2 Product Description Luteinizing Hormone Releasing Hormone (LH-RH) is a...
$152.00
... more info

Linear RGDfK Peptide

Catalog Number LT9457 Product Name Linear RGDfK Peptide Product Quantity 1 mg Sequence / Structure RGDfK Purity ≥95% Scientific Background Linear RGDfK provides a noncyclized comparator for cyclic RGD ligands and a lysine handle for...
$152.00
... more info

Linear RGDyK Peptide

Catalog Number LT9458 Product Name Linear RGDyK Peptide Product Quantity 1 mg Sequence / Structure RGDyK Purity ≥95% Scientific Background Linear RGDyK combines the RGD integrin-binding motif with tyrosine and a derivatizable lysine. It is...
$155.00
... more info

Listeria LLO (91-99)

Catalog Number LT9417 Product Name Listeria LLO (91-99) Product Quantity 1 mg Sequence GYKDGNEYI Molecular Weight TBD Purity ≥95% Scientific Background Listeriolysin O(91-99) is a dominant H-2Kd-restricted CD8 T-cell epitope from...
$263.52
... more info

Litorin

Product Name Litorin Product Quantity 10mg Catalog Number LT1755 Molecular Weight 1085.28 Formula C51H68N14O11S1 Sequence Pyr-Gln-Trp-Ala-Val-Gly-His-Phe-Met-NH2 Scientific Background Litorin is a 8-residue synthetic peptide with the sequence Gln-Tr...
$182.00
... more info

LKBtide LKB1/STK11 Substrate Peptide

Catalog Number LT8909 Product Name LKBtide LKB1/STK11 Substrate Peptide Product Quantity 1 mg Sequence LSNLYHQGKFLQTFCGSPLYRRR Molecular Weight 2785.4 Formula C126H194N38O32S Purity ≥95% Scientific Background LKBtide is a synthetic peptide...
$336.96
... more info

LKRApYLG-NH2

Product Name LKRApYLG-NH2 Product Quantity 5mg Catalog Number LT1756 Molecular Weight 899.03 Formula C38H67N12O11P Sequence Leu-Lys-Arg-Ala-pTyr-Leu-Gly-NH2 Scientific Background LKRApYLG-NH2 is a 6-residue synthetic peptide with the sequence Leu-Ly...
$197.00
... more info

LL-37 Antimicrobial Peptide, Human

Catalog Number LT9369 Product Name LL-37 Antimicrobial Peptide, Human Product Quantity 1 mg Sequence [LL-37, 37 aa] Molecular Weight 4493.6 Purity ≥95% Scientific Background LL-37 is the only human cathelicidin-der...
$881.28
... more info

LL-37 pentamide

Product Name LL-37 pentamide Product Quantity 5mg Catalog Number LT1757 Molecular Weight 4522.46 Formula C208H343N65O48 Sequence Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-L...
$156.00
... more info

LL-37 Reverse Sequence Control Peptide

Catalog Number LT8843 Product Name LL-37 Reverse Sequence Control Peptide Product Quantity 0.5 mg Sequence SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL CAS Number 2022972-70-7 Molecular Weight 4493.6 Formula C205H340N60O53 Purity ≥95% Scientific...
Displaying 1771 to 1780 (of 2644 Products)