Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1741 to 1750 (of 2644 Products)
Price Product Name
$152.00
... more info

LAT pTyr171 Peptide

Catalog Number LT9486 Product Name LAT pTyr171 Peptide Product Quantity 1 mg Sequence VPCpYENL Purity ≥95% Scientific Background LAT is a central adaptor in T-cell receptor signaling. Phosphorylated Tyr171 contributes to assembly of signaling...
$275.00
... more info

LAT pTyr191 Peptide

Catalog Number LT9487 Product Name LAT pTyr191 Peptide Product Quantity 1 mg Sequence GEEEGAPDpYENLQELN Purity ≥95% Scientific Background LAT pTyr191 is a major adaptor docking site involved in Grb2/Gads-containing signaling complexes...
$141.00
... more info

LC-LL-37, 5-FAM-Labeled

Catalog Number LT9371 Product Name LC-LL-37, 5-FAM-Labeled Product Quantity 0.1 mg Sequence 5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Molecular Weight 4965.0 Purity ≥95% Scientific Background 5-FAM-LC-LL-37 is a fluorescent LL-37...
$351.00
... more info

LC-LL-37, N-Terminal Cys

Catalog Number LT9370 Product Name LC-LL-37, N-Terminal Cys Product Quantity 1 mg Sequence C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Molecular Weight 4709.9 Purity ≥95% Scientific Background This LL-37 derivative adds an N-terminal...
$155.00
... more info

LCMV GP33-41

Catalog Number LT9412 Product Name LCMV GP33-41 Product Quantity 1 mg Sequence KAVYNFATC Molecular Weight TBD Purity ≥95% Scientific Background LCMV GP33-41 is an immunodominant H-2Db-restricted CD8 T-cell epitope from lymphocytic...
$320.00
... more info

LCMV GP61-80

Catalog Number LT9413 Product Name LCMV GP61-80 Product Quantity 1 mg Sequence GLKGPDIYKGVYQFKSVEFD Molecular Weight TBD Purity ≥95% Scientific Background LCMV GP61-80 is an I-Ab-restricted CD4 T-cell epitope from viral glycoprotein. It...
$80.00
... more info

LCMV NP396-404, H-2Db Epitope

Catalog Number LT9410 Product Name LCMV NP396-404, H-2Db Epitope Product Quantity 1 mg Sequence FQPQNGQFI Molecular Weight 1078.3 Purity ≥95% Scientific Background LCMV NP396-404 is an immunodominant H-2Db-restricted CD8 T-cell epitope...
$959.04
... more info

LEAP-2 (38 - 77) (Human)

Product Name LEAP-2 (38 - 77) (Human) Product Quantity 5mg Catalog Number LT1732 Molecular Weight 4585.36 Formula C191H320N64O57S5 Sequence Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cy...
$660.96
... more info

Leptin (116-130), mouse

Product Name Leptin (116-130), mouse Product Quantity 5mg Catalog Number LT1733 Molecular Weight 1560.74 Formula C64H107N18O25S1 Sequence Ser-Cys-Ser-Leu-Pro-Gln-Thr-Ser-Gly-Leu-Gln-Lys-Pro-Glu-Ser Product Description Leptin (Greek leptos meaning...
$1,360.80
... more info

Leptin (22-56), human; OBGRP(22-56), human

Product Name Leptin (22-56), human; OBGRP(22-56), human Product Quantity 5mg Catalog Number LT1734 Molecular Weight 3950.6 Formula C171H298N50O56 Sequence Val-Pro-Ile-Gln-Lys-Val-Gln-Asp-Asp-Thr-Lys-Thr-Leu-Ile-Lys-Thr-Ile-Val-Thr-Arg-Ile-Asn-Asp-Ile...
Displaying 1741 to 1750 (of 2644 Products)