Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1401 to 1410 (of 2644 Products)
Price Product Name
$1,257.12
... more info

GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mou

Product Name GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mou Product Quantity 5mg Catalog Number LT1496 Molecular Weight 3652.18 Formula C165H252N44O48S Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala...
$693.36
... more info

GLP-1 (9-36) amide (human,bovine, guinea pig, mouse,porcine, rat

Product Name GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat Product Quantity 5mg Catalog Number LT1497 Molecular Weight 3089.48 Formula C140H214N36O43 Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Ly...
$660.00
... more info

GLP-1-Cysteine (1-37) (human, bovine,guinea pig, mouse, rat)

Product Name GLP-1-Cysteine (1-37) (human, bovine, guinea pig, mouse, rat) Product Quantity 5mg Catalog Number 555677 Molecular Weight 4272.71 Formula C189H280N52O60S1 Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-T...
$790.56
... more info

GLP-2 (1-33) (human)

Product Name GLP-2 (1-33) (human) Product Quantity 5mg Catalog Number LT1498 Molecular Weight 3766.2 Formula C165H254N44O55S1 Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr...
$810.00
... more info

GLP-2 (1-34) (human)

Product Name GLP-2 (1-34) (human) Product Quantity 5mg Catalog Number LT1499 Molecular Weight 3922.38 Formula C171H266N48O56S1 Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Th...
$790.56
... more info

GLP-2 (rat)

Product Name GLP-2 (rat) Product Quantity 5mg Catalog Number LT1500 Molecular Weight 3796.22 Formula C166H256N44O56S1 Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile...
$528.00
... more info

GLP-2, Human

Catalog Number LT9345 Product Name GLP-2, Human Product Quantity 0.1 mg Sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD Molecular Weight 3767.1 Purity ≥95% Scientific Background Human GLP-2 is a 33-residue proglucagon-derived intestinal hormone...
$213.84
... more info

Glucagon - Like Peptide 1 (7 -17) - Cys, GLP - 1 (7 - 17) – Cys

Product Name Glucagon - Like Peptide 1 (7 -17) - Cys, GLP - 1 (7 - 17) – Cys Product Quantity 5mg Catalog Number LT1501 Molecular Weight 4421.92 Formula C192H295N59O60S Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Cys Scientific Background ...
$738.72
... more info

Glucagon - Like Peptide 1 (7 -37)

Product Name Glucagon - Like Peptide 1 (7 -37) Product Quantity 5mg Catalog Number LT1502 Molecular Weight 3337.73 Formula C151H226N40O46 Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu...
$738.72
... more info

Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human Product Quantity 5mg Catalog Number LT1507 Molecular Weight 3297.7 Formula C149H229N40O45 Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-...
Displaying 1401 to 1410 (of 2644 Products)