Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1451 to 1460 (of 2644 Products)
Price Product Name
$537.84
... more info

GRF (1-29) amide (rat)

Product Name GRF (1-29) amide (rat) Product Quantity 5mg Catalog Number LT1537 Molecular Weight 3473.1 Formula C155H251N49O40S Sequence His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Ar...
$1,049.76
... more info

GRF (free acid) (human)

Product Name GRF (free acid) (human) Product Quantity 5mg Catalog Number LT1538 Molecular Weight 5040.74 Formula C215H357N71O67S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-...
$1,075.68
... more info

GRF, porcine

Product Name GRF, porcine Product Quantity 5mg Catalog Number LT1539 Molecular Weight 5108.86 Formula C219H365N73O66S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln...
$80.00
... more info

Growth Hormone Releasing Factor (GRF) (1-29)-NH2, Human

Catalog Number LT9326 Product Name Growth Hormone Releasing Factor (GRF) (1-29)-NH2, Human Product Quantity TBD Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Molecular Weight 3358.1 Purity ≥95% Scientific Background Human GRF(1-29)-NH2 is...
$537.84
... more info

Growth Hormone Releasing Factor, GRF (1 - 29), amide,human

Product Name Growth Hormone Releasing Factor, GRF (1 - 29), amide, human Product Quantity 5mg Catalog Number LT1544 Molecular Weight 3357.96 Formula C149H246N44O42S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-...
$978.48
... more info

Growth Hormone Releasing Factor, GRF (1 - 40), amide,human

Product Name Growth Hormone Releasing Factor, GRF (1 - 40), amide, human Product Quantity 5mg Catalog Number LT1545 Molecular Weight 4543.14 Formula C194H318N62O62S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-...
$1,075.68
... more info

Growth Hormone Releasing Factor, GRF (1 - 44), amide,bovine

Product Name Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine Product Quantity 5mg Catalog Number LT1546 Molecular Weight 5107.88 Formula C220H366N72O66S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala...
$959.04
... more info

Growth Hormone Releasing Factor, GRF, (1 - 40), human

Product Name Growth Hormone Releasing Factor, GRF, (1 - 40), human Product Quantity 5mg Catalog Number LT1547 Molecular Weight 4544.12 Formula C194H317N61O63S Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Ly...
$285.12
... more info

GRP (1-16) (porcine)

Product Name GRP (1-16) (porcine) Product Quantity 5mg Catalog Number LT1548 Molecular Weight 1546.9 Formula C70H115N17O20S1 Sequence Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro Scientific Background GRP (1-16) (porcine) is a...
$252.72
... more info

GRP (14-27) (human, porcine,canine)

Product Name GRP (14-27) (human, porcine, canine) Product Quantity 5mg Catalog Number LT1549 Molecular Weight 1668 Formula C75H110N24O16S2 Sequence Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Scientific Background GRP (14-27) (human,...
Displaying 1451 to 1460 (of 2644 Products)