Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 1231 to 1240 (of 2644 Products)
Price Product Name
$660.96
... more info

Egg Laying Hormone of Aplysia

Product Name Egg Laying Hormone of Aplysia Product Quantity 5mg Catalog Number LT1372 Molecular Weight 4384.17 Formula C190H329N59O57S1 Sequence Ile-Ser-Ile-Asn-Gln-Asp-Leu-Lys-Ala-Ile-Thr-Asp-Met-Leu-Leu-Thr-Glu-Gln-Ile-Arg-Glu-Arg-Gln-Arg-Tyr-Leu-A...
$270.00
... more info

Eglin c (41-49)

Product Name Eglin c (41-49) Product Quantity 10mg Catalog Number LT1373 Molecular Weight 1063.23 Formula C48H78N12O15 Sequence Ser-Pro-Val-Thr-Leu-Asp-Leu-Arg-Tyr Scientific Background Eglin c (41-49) is a 9-residue synthetic peptide with the...
$291.60
... more info

Eglin c (60-63)-methyl ester

Product Name Eglin c (60-63)-methyl ester Product Quantity 10mg Catalog Number LT1374 Molecular Weight 445.49 Formula C19H35N5O7 Sequence Thr-Asn-Val-Val-Ome Scientific Background Eglin c (60-63)-methyl ester is a 4-residue synthetic peptide with...
$508.00
... more info

Elabela/Toddler (ELA-32), Human

Catalog Number LT9292 Product Name Elabela/Toddler (ELA-32), Human Product Quantity 0.1 mg Sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP Molecular Weight TBD Purity ≥95% Scientific Background Elabela, also called Toddler or APELA, is an...
$112.00
... more info

Elastase Fluorogenic Substrate, (Z-AAAA)2Rh110

Catalog Number LT8838 Product Name Elastase Fluorogenic Substrate, (Z-AAAA)2Rh110 Product Quantity 5 mg Sequence (Z-AAAA)2Rh110 CAS Number 149695-85-2 Molecular Weight 1167.2 Formula C60H66N10O15 Purity ≥95% Scientific Background (Z-Ala-Ala-Al...
$112.00
... more info

Elastase/Trypsin Fluorogenic Substrate, (Z-AR)2Rh1102HCl

Catalog Number LT8839 Product Name Elastase/Trypsin Fluorogenic Substrate, (Z-AR)2Rh110·2HCl Product Quantity 5 mg Sequence (Z-AR)2Rh110·2HCl Molecular Weight 1053.1 Purity ≥95% Scientific Background (Z-Ala-Arg)2Rh110·2HCl is a...
$1,334.88
... more info

Elcatonin Acetate

Product Name Elcatonin Acetate Product Quantity 5mg Catalog Number LT1377 Molecular Weight M.W.3363.8 Formula C148H244N42O47 Sequence Ser-Asn-Leu-Ser-Thr-Asu-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-...
$250.00
... more info

Eledoisin

Product Name Eledoisin Product Quantity 5mg Catalog Number LT1378 Molecular Weight 1188.44 Formula C54H85N13O15S1 Sequence Pyr-Pro-Ser-Lys-Asp-Ala-Phe-Ile-Gly-Leu-Met-NH2 Related Product Neurokinin A: HKTDSFVGLM Neurokinin A (4-10): DSFVGLM...
$185.00
... more info

Eledoisin

Catalog Number LT9261 Product Name Eledoisin Product Quantity 1 mg Sequence Pyr-PSKDAFIGLM-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Eledoisin is a naturally occurring tachykinin from cephalopod salivary glands. Its conserved...
$250.00
... more info

Eledoisin Related Peptide

Product Name Eledoisin Related Peptide Product Quantity 5mg Catalog Number LT1379 Molecular Weight 706.96 Formula C34H58N8O6S1 Sequence Lys-Phe-Ile-Gly-Leu-Met-NH2 Related Product Neurokinin A: HKTDSFVGLM Neurokinin A (4-10): DSFVGLM Neurokinin B:...
Displaying 1231 to 1240 (of 2644 Products)