Cy3-Labeled EV Glioblastoma Targeting Peptide

Product Name
Cy3-Labeled EV Glioblastoma Targeting Peptide
Product Quantity
4 mg
Purity
>95%
Catalog Number
LT8675
Peptide Type
Tandem glioblastoma-targeting peptide with fluorescent label
Sequence
AWEFYFPGGGGSGGGGSGGGGSSSQPFWS-Cys(Cy3)
Published / Parent Sequence
AWEFYFPGGGGSGGGGSGGGGSSSQPFWS
Product Description

Cy3-Labeled EV Glioblastoma Targeting Peptide is based on a published tandem glioblastoma-targeting peptide that combines two GSC-selective motifs, AWEFYFP and SSQPFWS, through a glycine/serine-rich spacer. The published tandem sequence is AWEFYFPGGGGSGGGGSGGGGSSSQPFWS.

AWEFYFP was isolated through both in-vitro and intracranial in-vivo GSC biopanning, whereas SSQPFWS was recovered from an in-vivo flank xenograft screen. The two motifs were subsequently combined to create a multivalent targeting element for glioma stem-cell recognition.

Tandem GSC-Targeting Design

The flexible GGGGSGGGGSGGGGS linker separates the two targeting motifs and is intended to reduce steric interference while allowing both peptide regions to remain accessible. Glycine/serine-rich linkers are commonly used in protein and peptide engineering because of their flexibility and relatively low structural bias.

The tandem peptide was evaluated in research directed toward GSC-targeted CAR constructs and glioblastoma recognition. Published work reported selective targeting of GSC populations and demonstrated how peptide ligands discovered by phage display can be incorporated into larger engineered recognition systems.

Cy3-Labeled LifeTein Product

LT8675 contains a C-terminal cysteine configured with Cy3. This fluorescent reporter provides direct optical detection of the tandem peptide in cell-binding, microscopy, trafficking, or localization experiments.

The 2023 publication explicitly reports the tandem sequence and describes a Cy3-conjugated peptide synthesized by LifeTein for experimental studies.

Potential Research Applications

  • GSC-binding and specificity assays
  • Fluorescence microscopy
  • Flow cytometry
  • Targeting-ligand comparison
  • Multivalent peptide engineering
  • Glioblastoma targeting studies
  • Peptide-guided receptor or CAR design research

References

Kim J, et al. Glioblastoma Stem Cell Targeting Peptide Isolated Through Phage Display Binds Cadherin 2. Stem Cells. 2023;41(8):762-774.
doi: 10.1093/stmcls/sxad045.
Public source / publication

Kim J, et al. Use of phage display biopanning as a tool to design CAR-T cells against glioma stem cells. Front Oncol. 2023;13:1124272.
doi: 10.3389/fonc.2023.1124272.
Public source / publication

Related LifeTein Services

Custom Peptide Synthesis
Fluorescent Peptide Labeling
Peptide Click Chemistry and Conjugation
Peptide Carrier Protein Conjugation

Research Use Only. Not for human, diagnostic, clinical, or therapeutic use.

  • 1 Units in Stock
Ask a Question

Add to Cart: