Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2511 to 2520 (of 2783 Products)
Price Product Name
$427.68
... more info

Secretin (5 - 27), porcine

Product Name Secretin (5 - 27), porcine Product Quantity 5mg Catalog Number LT2198 Molecular Weight 2659.11 Formula C115H200N38O34 Sequence Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-nh2 Scientific...
$680.40
... more info

Secretin-Lys(Biotin), human

Product Name Secretin-Lys(Biotin), human Product Quantity 5mg Catalog Number LT2202 Molecular Weight 3039.5 Formula C130H220N44O40 Sequence...
$498.96
... more info

Secretin, human

Product Name Secretin, human Product Quantity 5mg Catalog Number LT2199 Molecular Weight 3039.47 Formula C130H220N44O40 Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 Product...
$424.00
... more info

Secretin, Human

Catalog Number LT9341 Product Name Secretin, Human Product Quantity 1 mg Sequence HSDGTFTSELSRLREGARLQRLLQGLV-NH2 Molecular Weight TBD Purity ≥95% Scientific Background Human secretin is a 27-residue amidated gastrointestinal hormone released...
$498.96
... more info

Secretin, porcine

Product Name Secretin, porcine Product Quantity 5mg Catalog Number LT2200 Molecular Weight 3055.47 Formula C130H220N44O41 Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2...
$498.96
... more info

Secretin, rat

Product Name Secretin, rat Product Quantity 5mg Catalog Number LT2201 Molecular Weight 3027.42 Formula C129H216N42O42 Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Gln-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 Scientific...
$337.00
... more info

Secretoneurin

Catalog Number LT8849 Product Name Secretoneurin Product Quantity 1 mg Sequence TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ CAS Number 149146-12-3 Molecular Weight 3652.2 Formula C159H252N40O58 Purity ≥95% Scientific Background Secretoneurin is a...
$528.00
... more info

Secretoneurin, Human

Catalog Number LT9230 Product Name Secretoneurin, Human Product Quantity 1 mg Sequence TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ Molecular Weight TBD Purity ≥95% Scientific Background Secretoneurin is a neuropeptide generated from secretogranin II....
$213.84
... more info

Selectin

Product Name Selectin Product Quantity 5mg Catalog Number LT2203 Molecular Weight 1426.75 Formula C62H105N16O18S2 Sequence Cys-Gln-Lys-Leu-Asp-Lys-Ser-Phe-Ser-Met-Ile-Lys Scientific Background Selectin is a 12-residue synthetic peptide with the...
$285.12
... more info

Sendai Virus Nucleoprotein (321-336)

Product Name Sendai Virus Nucleoprotein (321-336) Product Quantity 5mg Catalog Number LT2204 Molecular Weight 1779.93 Formula C85H110N20O23 Sequence His-Gly-Glu-Phe-Ala-Pro-Gly-Asn-Tyr-Pro-Ala-Leu-Trp-Ser-Tyr-Ala Scientific Background Sendai Virus...
Displaying 2511 to 2520 (of 2783 Products)