Catalog Number | LT8813 |
Product Name | Preptin, Human Pro-IGF-II-Derived Peptide |
Product Quantity | 1 mg |
Sequence | DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL |
CAS Number | 11097-48-6 |
Molecular Weight | 4029.52 |
Formula | C187H275N47O53 |
Purity | ≥95% |
Scientific Background | Preptin is a 34-residue peptide corresponding to Asp69-Leu102 of the pro-IGF-II E-peptide. It was originally isolated from pancreatic beta-cell secretory granules and shown to be co-secreted with insulin in response to glucose. In the original study, synthetic preptin enhanced glucose-stimulated insulin secretion in beta-cell and perfused-pancreas models. Later work has continued to examine preptin as a sequence-defined pro-IGF-II-derived peptide in pancreatic and metabolic signaling research. |
Research Applications | - beta-cell secretion studies
- glucose-stimulated insulin secretion research
- pro-IGF-II peptide biology
- metabolic signaling studies
|
Experimental Notes | Preptin should be treated as a research peptide derived from pro-IGF-II rather than as an interchangeable substitute for IGF-II. Reported insulin-secretory effects depend on the experimental beta-cell or pancreas model. |
Selected References | - Preptin derived from proinsulin-like growth factor II is secreted from pancreatic islet beta-cells and enhances insulin secretion
- Characterization of preptin-induced insulin secretion in pancreatic beta-cells
|
