Catalog Number | LT9006 |
Product Name | Preptin, Human Pro-IGF-II (69-102) |
Product Quantity | 1 mg |
Sequence | DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL-OH |
CAS Number | 11097-48-6 |
Molecular Weight | 4029.52 |
Formula | C187H275N47O53 |
Purity | ≥95% |
| Scientific Background | Preptin is a 34-residue peptide derived from the E-peptide region of pro-insulin-like growth factor II and is co-secreted with insulin from pancreatic beta cells. The original biochemical characterization identified preptin in beta-cell secretory granules and showed that synthetic preptin amplified glucose-stimulated insulin secretion. Subsequent studies have examined preptin in pancreatic physiology, metabolism and bone biology. |
| Research Applications | - pancreatic beta-cell research
- glucose-stimulated insulin secretion
- pro-IGF-II peptide biology
- metabolic and endocrine studies
|
| Experimental Notes | The LifeTein product is the free-acid 34-residue peptide with CAS 11097-48-6, MW 4029.52 and ≥95% HPLC purity. Preptin biology is still an active research area; descriptions should distinguish experimental findings from clinical claims. |
| Selected References | - Preptin derived from proinsulin-like growth factor II is secreted from pancreatic islet beta-cells and enhances insulin secretion
- Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo
|
