Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 711 to 720 (of 2644 Products)
Price Product Name
$81.00
... more info

Beta-Amyloid (2-42)

Catalog Number LT9165 Product Name Beta-Amyloid (2-42) Product Quantity TBD Sequence AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight TBD Purity ≥95% Scientific Background Aβ(2-42) lacks the N-terminal Asp1 while...
$230.00
... more info

Beta-Amyloid (22-35)

Catalog Number LT9168 Product Name Beta-Amyloid (22-35) Product Quantity 1 mg Sequence EDVGSNKGAIIGLM Molecular Weight TBD Purity ≥95% Scientific Background Aβ(22-35) spans the central-to-C-terminal transition of amyloid-beta and...
$350.00
... more info

Beta-Amyloid (31-40)

Product Name Beta-Amyloid (31-40) Product Quantity 5 mg Catalog Number LT8315 Molecular Weight 912.16 Formula C44H82N10O11 Sequence Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val, IIGLMVGGVV Product Description Beta-Amyloid (31-40), sequence IIGLMVGGVV ,...
$644.00
... more info

Beta-Amyloid (4-42)

Catalog Number LT9172 Product Name Beta-Amyloid (4-42) Product Quantity 1 mg Sequence FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight TBD Purity ≥95% Scientific Background Aβ(4-42) is an N-terminally truncated Aβ42...
$712.00
... more info

Beta-Amyloid (42-1), Reverse

Catalog Number LT9174 Product Name Beta-Amyloid (42-1), Reverse Product Quantity TBD Sequence AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Molecular Weight TBD Purity ≥95% Scientific Background Reverse Aβ(42-1) contains the Aβ42...
$151.00
... more info

Beta-Amyloid (5-42)

Catalog Number LT9166 Product Name Beta-Amyloid (5-42) Product Quantity TBD Sequence RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight 4051.9 Purity ≥95% Scientific Background Aβ(5-42) is an N-terminally truncated Aβ42...
$300.00
... more info

Beta-Amyloid (7-22)

Product Name Beta-Amyloid (7-22) Product Quantity 5mg Catalog Number LT2473 Molecular Weight 1906.1 Formula C88H124N22O26 Sequence Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu, DSGYEVHHQKLVFFAE Scientific Background Beta-Amyloid (...
$314.00
... more info

Beta-Amyloid Peptide (1-40), Mouse/Rat

Catalog Number LT9162 Product Name Beta-Amyloid Peptide (1-40), Mouse/Rat Product Quantity TBD Sequence DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Molecular Weight 4233.8 Purity ≥95% Scientific Background Mouse/rat Aβ40 differs from...
$419.00
... more info

Beta-Amyloid Peptide (1-42), Mouse/Rat

Catalog Number LT9163 Product Name Beta-Amyloid Peptide (1-42), Mouse/Rat Product Quantity 0.5 mg Sequence DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight 4418.3 Purity ≥95% Scientific Background Mouse/rat Aβ42 contains...
$350.00
... more info

Beta-Amyloid Protein Precursor (657 - 676)

Product NameBeta-Amyloid Protein Precursor (657 - 676)Product Quantity5mgCatalog Number LT2476Molecular Weight2210.45FormulaC95H152N30O31SequenceHis-His-Gly-Val-Val-Glu-Val-Asp-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys, HHGVVEVDAAVTPEERHLSK
Displaying 711 to 720 (of 2644 Products)