Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2501 to 2510 (of 2644 Products)
Price Product Name
$427.68
... more info

TAT 2-4

Product Name TAT 2-4 Product Quantity 5mg Catalog Number LT2287 Molecular Weight 3215.81 Formula C132H240N66O29 Sequence Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly Product Description The HIV Tat-...
$105.00
... more info

Tat-GluR2-3Y Scrambled Control Peptide

Catalog Number LT8850 Product Name Tat-GluR2-3Y Scrambled Control Peptide Product Quantity 1 mg Sequence YGRKKRRQRRRVYKYGGYNE CAS Number 1404188-94-8 Molecular Weight 2634.1 Formula C115H185N43O29 Purity ≥95% Scientific Background ...
$105.00
... more info

TAT-GluR23A Fusion Peptide

Catalog Number LT8884 Product Name TAT-GluR23A Fusion Peptide Product Quantity 1 mg Sequence YGRKKRRQRRRAKEGANVAG Molecular Weight 2357.8 Formula C97H173N43O26 Purity ≥95% Scientific Background YGRKKRRQRRRAKEGANVAG is a cell-permeable TAT-GluR...
$240.00
... more info

TAT-HA2 Fusion Peptide

Catalog Number LT8883 Product Name TAT-HA2 Fusion Peptide Product Quantity 1 mg Sequence RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG Molecular Weight 3433.2 Formula C149H243N53O39S Purity ≥95% Scientific Background RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG is a...
$372.00
... more info

TAT-NSF222 Fusion Peptide

Catalog Number LT8875 Product Name TAT-NSF222 Fusion Peptide Product Quantity 1 mg Sequence YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE Molecular Weight 4240.1 Purity ≥95% Scientific Background TAT-NSF222 is a cell-permeable fusion peptide composed...
$366.00
... more info

TAT-NSF222scr Scrambled Control Peptide

Catalog Number LT8876 Product Name TAT-NSF222scr Scrambled Control Peptide Product Quantity 1 mg Sequence YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE Molecular Weight 4215.1 Purity ≥95% Scientific Background TAT-NSF222scr is a scrambled-sequence...
$390.00
... more info

TAT-NSF700 Fusion Peptide

Catalog Number LT8772 Product Name TAT-NSF700 Fusion Peptide Product Quantity 1 mg Sequence YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL Molecular Weight 4167.2 Purity ≥95% Scientific Background TAT-NSF700 is a cell-permeable fusion peptide...
$366.00
... more info

TAT-NSF700scr Scrambled Control Peptide

Catalog Number LT8874 Product Name TAT-NSF700scr Scrambled Control Peptide Product Quantity 1 mg Sequence YGRKKRRQRRR-GGG-IPPVYFSRLDLNLVVLLLAQL Molecular Weight 4110.2 Formula C186H315N61O44 Purity ≥95% Scientific Background TAT-NSF700scr is...
$489.00
... more info

Tau Peptide (244-274), Human

Catalog Number LT9241 Product Name Tau Peptide (244-274), Human Product Quantity 1 mg Sequence QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK Molecular Weight TBD Purity ≥95% Scientific Background Tau(244-274) lies near the beginning of the microtubule-bindi...
$489.00
... more info

Tau Peptide (306-336), Human

Catalog Number LT9242 Product Name Tau Peptide (306-336), Human Product Quantity 1 mg Sequence VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ Molecular Weight TBD Purity ≥95% Scientific Background Tau(306-336) contains the VQIVYK hexapeptide motif, a key...
Displaying 2501 to 2510 (of 2644 Products)