Peptides

A generic image

Featured Peptide Promotions and Research Peptide Products

LifeTein provides peptides, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies. This page highlights selected peptide promotions, including beta-amyloid peptides, amylin, epitope tag peptides, cell-penetrating peptides, and LPETG motif peptides for sortase-mediated ligation and conjugation studies.


   Advanced Search
peptide promotion beta amyloid peptide

Promotional Pricing

Selected peptide products are available at discounted prices for research use.

Neuroscience Peptides

Beta-amyloid and amylin peptides for Alzheimer’s disease and related research applications.

Sortase and Tag Peptides

LPETG motif peptides, labeling peptides, and epitope-tag peptides for conjugation and purification studies.

Featured Beta-Amyloid and Amylin Peptides

Order Amylin (1-37), human at the discounted price.

Beta-Amyloid (Aβ or Abeta) is a peptide processed from amyloid precursor protein (APP). Beta-amyloid is typically a 39-43 amino acid peptide derived from the extracellular and transmembrane regions of APP. APP is expressed as several isoforms, including proteins of 695, 751, and 770 amino acids.

Beta-amyloid plays a central role in information processing in the brain, and abnormal amyloid deposition is a major histopathological hallmark of Alzheimer’s disease. Aβ40 and Aβ42 are widely studied because of their association with neurotoxicity and amyloid plaque formation in Alzheimer’s disease and related disorders.


Featured LPETG and Sortase Motif Peptides

LPETG and LPXTG motif peptides are widely used in sortase-mediated ligation, protein labeling, and site-specific conjugation workflows. LifeTein offers biotinylated, fluorescently labeled, and modified LPETG peptides for research applications.

LPETG LPXTG motif
Cat. No. Product Name Applications Price Order
5467 Biotin-Ahx-LPETGS-NH2 LPXTG motif recognized by Sortase A (SrtA), amidated form $280
add to cart
6142 Biotin-Ahx-LPETGS-COOH LPXTG motif recognized by Sortase A (SrtA), free acid form $280
add to cart
5716 Biotin-AALPETG*G, G* = 2-hydroxyacetic acid 2-hydroxyacetic acid modified peptide $320
add to cart
6271 FITC-Ahx-LPETGS FITC labeling of peptides by SrtA $280
add to cart
6272 Rhodamine B-Ahx-LPETGS Rhodamine labeling of peptides by SrtA $450
add to cart
6148 Biotin-Ahx-LPETG-NH2 LPETG motif peptide $280
add to cart
5747 Biotin-ALPETGG LPETG motif, SrtA applications $280
add to cart
5989 Cy5-Cys-HHHHHHHHHLPETGG Cy5-labeled peptide $480
add to cart
35816 VC-PAB-MMAE-LPETGG Monomethyl auristatin E (MMAE) conjugate $420
add to cart

Other Featured Peptide Products

This section highlights selected neuroscience peptides, epitope-tag peptides, cell-penetrating peptides, and commonly used research peptides.

Cat. No. Product Name Applications Price Order
LT2460 Beta-Amyloid (1-42), human Alzheimer's disease study $1,500 $300
add to cart
LT1340 DYKDDDDK-Cysteine peptide (FLAG) Control peptide, affinity purification $50
add to cart
LT12006 HHHHHH-Cysteine Affinity purification $50
add to cart
LT12013 FITC-Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRRGK(FITC) $150 $120
add to cart
LT12005 Stearyl-R8 Cell-penetrating peptide, Stearyl-RRRRRRRR $260 $180
add to cart
LT12001 PolyLys-Cys-SH KKKKKKC $55 $30
add to cart
LT2353 V5 Epitope Tag V5 epitope, affinity purification $153 $130
add to cart
LT110006 Amylin (1-37), human 37 amino acid polypeptide $400 $199
add to cart

Need Help Finding the Right Peptide?

Contact us for product recommendations, bulk pricing, custom peptide requests, and related research reagents.

Contact Us

Displaying 2351 to 2360 (of 2644 Products)
Price Product Name
$1,017.36
... more info

Sarafotoxin S6b

Product Name Sarafotoxin S6b Product Quantity 5mg Catalog Number LT2187 Molecular Weight 2514.9 Formula C105H156N28O34S5 Sequence Cys-Ser-Cys-Lys-Asp-Met-Thr-Asp-Lys-Glu-Cys-Leu-Tyr-Phe-Cys-His-Gln-Asp-Val-Ile-Trp(Disulfide bridge: Cys1-Cys15, Cys3-C...
$335.00
... more info

Sarafotoxin S6b

Catalog Number LT9296 Product Name Sarafotoxin S6b Product Quantity 0.1 mg Sequence CSCKDMTDKECLYFCHQDVIW (Disulfide 1-15, 3-11) Molecular Weight TBD Purity ≥95% Scientific Background Sarafotoxin S6b is a snake-venom peptide structurally...
$498.96
... more info

Sarafotoxin S6c

Product Name Sarafotoxin S6c Product Quantity 5mg Catalog Number LT2188 Molecular Weight 2519.8 Formula C103H151N27O37S5 Sequence Cys-Thr-Cys-Asn-Asp-Met-Thr-Asp-Glu-Glu-Cys-Leu-Asn-Phe-Cys-His-Gln-Asp-Val-Ile-Trp Scientific Background Sarafotoxin...
$375.84
... more info

Sarafotoxin S6d

Product Name Sarafotoxin S6d Product Quantity 5mg Catalog Number LT2189 Molecular Weight 2592.03 Formula C112H167N27O34S5 Sequence Cys-Thr-Cys-Lys-Asp-Met-Thr-Asp-Lys-Glu-Cys-Leu-Tyr-Phe-Cys-His-Gln-Asp-Ile-Ile-Trp Scientific Background Sarafotoxin...
$331.00
... more info

SARS-CoV Peptide Antigen I

Catalog Number LT9397 Product Name SARS-CoV Peptide Antigen I Product Quantity 1 mg Sequence VLNDILSRL Molecular Weight 1042.3 Purity ≥95% Scientific Background VLNDILSRL is a SARS-CoV spike-derived HLA-A2-associated T-cell epitope. It...
$155.00
... more info

SARS-CoV Peptide Antigen II

Catalog Number LT9398 Product Name SARS-CoV Peptide Antigen II Product Quantity 1 mg Sequence NLNESLIDL Molecular Weight TBD Purity ≥95% Scientific Background NLNESLIDL is a defined SARS-CoV T-cell antigen included in a validated spike-d...
$155.00
... more info

SARS-CoV Peptide Antigen III

Catalog Number LT9399 Product Name SARS-CoV Peptide Antigen III Product Quantity 1 mg Sequence FIAGLIAIV Molecular Weight TBD Purity ≥95% Scientific Background FIAGLIAIV is a hydrophobic SARS-CoV spike-derived T-cell antigen used in...
$335.00
... more info

SARS-CoV Spike Positive-Control Epitope

Catalog Number LT9400 Product Name SARS-CoV Spike Positive-Control Epitope Product Quantity 1 mg Sequence KLPDDFMGCV Molecular Weight 1124.4 Purity ≥95% Scientific Background KLPDDFMGCV corresponds to SARS-CoV spike residues 411-420 and...
$354.00
... more info

SARS-CoV T-cell Negative-Control Peptide

Catalog Number LT9401 Product Name SARS-CoV T-cell Negative-Control Peptide Product Quantity 1 mg Sequence AYRPPNAPIL Molecular Weight 1111.4 Purity ≥95% Scientific Background AYRPPNAPIL is an HBcAg-derived H-2b-restricted peptide used...
$483.00
... more info

SARS-CoV-2 Spike RBD (395-430)

Catalog Number LT9408 Product Name SARS-CoV-2 Spike RBD (395-430) Product Quantity 0.5 mg Sequence VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT Molecular Weight 4063.8 Purity ≥95% Scientific Background This 36-residue peptide spans SARS-CoV-2...
Displaying 2351 to 2360 (of 2644 Products)